Welcome to WormBase - need help?

Legend

default*XZ
unknown.
hydrophobicAGLMPV
large hydrophobicFHWY
small alcoholST
cysteineC
negativeDE
polarNQ
positive chargeKR

Protein Alignments

This is the Wormbase protein aligner. To use it, enter a WormBase protein ID.


(e.g. WP:CE25115 or BP:CBP00571)

RP:RP26668(Caenorhabditis remanei)CRE03833 Cre-unc-40
JA:JA57681(Caenorhabditis japonica)CJA07019b Cjp-unc-40
CN:CN16484(Caenorhabditis brenneri)CBN24134 Cbn-unc-40
BP:CBP38503(Caenorhabditis briggsae)CBG14917d Cbr-unc-40
OV:OVP04334(Onchocerca volvulus)OVOC1550 Ovo-unc-40
SRP:SRP08301(Strongyloides ratti)SRAE_2000245100
BM:BM45234(Brugia malayi)Bm5833 Bma-unc-40
ENSEMBL:ENSP00000389140(Homo sapiens)Netrin receptor DCC
SW:P70211(Mus musculus)Netrin receptor DCC
FLYBASE:CG8581(Drosophila melanogaster)Flybase gene name is fra-PA
WP:CE26976(Caenorhabditis elegans)H19M22.2a let-805
PP:PP48100(Pristionchus pacificus)PPA17835 Ppa-let-805
MUSCLE (v3.8.31) multiple sequence alignment
  
  
  WP:CE26976/1-4280              MGLRSRGLLLLSLGICYLQLFTLANVALNSNVRVKRQSGTDSLLTVEWEGIQTGDHADSE
  PP:PP48100/1-3609              --------------------------------------------------MQSFDIDEQS
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              VKGFLVEYRPERSGEWQLHPGIIPYKGPNHQYRVQIPKLPTGISYLVRIKVIGENNEVLV
  PP:PP48100/1-3609              PNLFLLQ---EREKMWQVHAGIIPYKGPNHQYRVQIAKLPTNTAYFVRIKVLGSNNDVIV
  SRP:SRP08301/1-1589            -----------------------------MKIFASIFLLIYHIGLFYICTLIFLSNATNI
  OV:OVP04334/1-1751             -----------------------------------MMHHITACALILYVFIIVLSKSVHC
  BM:BM45234/1-1465              ------------------------------------MDIIPSFALILYVFIIVLSKSAHC
  CN:CN16484/1-1420              -------------------------------------MKLRHFGCILIIITSYVSSTNAT
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              -------------------------------------MILRHFGFILIILTVYLSSTHAT
  RP:RP26668/1-1432              -----------------------MNSNMHKTFFTPLGIFIKISGYILLIIAVYLSSTNAN
  BP:CBP38503/1-1487             -------------------------------------MNLQHFGYILIILTVYLSTTLAT
  FLYBASE:CG8581/1-1526          -----------------------MAITTNRSSRTLWNWLLSSCLIFQLIGS---------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------MENSLRCVWVPKLAFVLFGASLFSAHLQVT
  SW:P70211/1-1447               ------------------------------MENSLGCVWVPKLAFVLFGASLLSAHLQVT
                                                                                             
  
  
  WP:CE26976/1-4280              ETPEIRAHNEIVSIKCENDDLTAPRYPQVT------------------------------
  PP:PP48100/1-3609              ETPEIRARNEIVTYNCPSDTLTAPRSPVVS------------------------------
  SRP:SRP08301/1-1589            PQYHSIRHITNKREVRSTLN----------------------------------------
  OV:OVP04334/1-1751             GDPDSVSNLSTVDNQGEFYRIIRERSVHDNELVKSKNNVMLYHGTIKVYLTYVKHLANLL
  BM:BM45234/1-1465              GSADSVKNSSIVGDQKS--RIFRKRSLPDN------------------------------
  CN:CN16484/1-1420              TRKHHRRSFEN-------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              TRKHHRRSIDN-------------------------------------------------
  RP:RP26668/1-1432              TRKHHRRSTEN-------------------------------------------------
  BP:CBP38503/1-1487             TRKHHRRSTEN-------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 GFQ---------------------------------------------------------
  SW:P70211/1-1447               GFQ---------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              -----EVAQYSLAIKWDAPDCGSVGDYQVELTGVSAPFDIHRQTVTQPHVSVTNLLPGTF
  PP:PP48100/1-3609              -----KSGAFSLAFEWEEPECGIVGEYQLELIGVTAPFDLHRQTITKPTVSITNLLPGSV
  SRP:SRP08301/1-1589            -----DDRQLNFRFLRQPESQ-IVKSNNSVILNCEFEVDKKDKL----------------
  OV:OVP04334/1-1751             RLFMLDDRFLGFHFTEEPTN--TVAKAGRVELNCRYAISMKN------------------
  BM:BM45234/1-1465              -----GDRFLGFHFTEEPTN--TVAKAGRIELNCRYAISMRN------------------
  CN:CN16484/1-1420              -----DSRAIGFQFVVEPKQDLNVVESSSYLLDCSYLLAHEKIV----------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              -----DARNLGFQFVMEPRRNVTVMESSSHLLECSYVLAHERLV----------------
  RP:RP26668/1-1432              -----DPRSIGFQFEIEPQRNVAVAESSSHLLECSYVLAHERFV----------------
  BP:CBP38503/1-1487             -----DPRSLGFQFEVEPRRNVTVSESTSHLLECSYVLAHERYV----------------
  FLYBASE:CG8581/1-1526          -----SLASQALSFTLEPQDA-VVPEGHSVLLQCAGTASIGRGGKSKSNLP---------
  ENSEMBL:ENSP00000389140/1-1447 -----IKAFTALRFLSEPSDAVTM-RGGNVLLDCSAESDR--------------------
  SW:P70211/1-1447               -----IKPFTSLHFVSEPSDAVTM-RGGNVLLNCSAESDR--------------------
                                                                                             
  
  
  WP:CE26976/1-4280              YSVKVRAADRSRNVGPWNSEVLEAKTKGDALPISNNIQLLYRTDSELRVSWQPFTDPRLQ
  PP:PP48100/1-3609              YQFRVRAADRNRVFGPW-SEMLAATTEGHTSPMINDIRVVYQSEGEIQIEWSPMEHEKLQ
  SRP:SRP08301/1-1589            ---------------------------------------------DIKIEWRK-------
  OV:OVP04334/1-1751             --------------------------------------------IASRIEWRK-------
  BM:BM45234/1-1465              --------------------------------------------TSSRTEWRK-------
  CN:CN16484/1-1420              --------------------------------------------QNVRVEWKR-------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              --------------------------------------------HDVRIEWKR-------
  RP:RP26668/1-1432              --------------------------------------------QTVKVEWKR-------
  BP:CBP38503/1-1487             --------------------------------------------QTVRVEWKR-------
  FLYBASE:CG8581/1-1526          --------------------------------------------SSVSIRWRG-------
  ENSEMBL:ENSP00000389140/1-1447 --------------------------------------------GVPVIKWKK-------
  SW:P70211/1-1447               --------------------------------------------GVPVIKWKK-------
                                                                                             
  
  
  WP:CE26976/1-4280              HYEVTAVEV-----DDDSRRVERRRVDPALNSFALTGLRPNTKYTIGVIAFVDHEPKQVY
  PP:PP48100/1-3609              NYEVMLTEAGGDSTDGEPKRVERVRLPSGTTSFILSTLKPNTKYHIGVAAIVDREPIRLS
  SRP:SRP08301/1-1589            ------------------------------DSLIVNSLRSTGR-----ILVLANNSILIE
  OV:OVP04334/1-1751             ------------------------------DGAELGSLRSTGK-----VFVASSGSLIIE
  BM:BM45234/1-1465              ------------------------------DGAELASLRPTGK-----MFVTSSGSLIIE
  CN:CN16484/1-1420              ------------------------------DGVTISE-RSSSR-----IRIMSNSSLWIE
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------DGVLLSE-RTSSR-----IKVMSNGSLWIE
  RP:RP26668/1-1432              ------------------------------DGVVLNE-RSSSR-----IKVMSNGSLWIE
  BP:CBP38503/1-1487             ------------------------------DGVMLSE-RSSSR-----IKVMSNGSLWIE
  FLYBASE:CG8581/1-1526          -----------------------------PDGQDLVIVGDTFR------TQLKNGSLYIS
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------DGIHLALGMDERK------QQLSNGSLLIQ
  SW:P70211/1-1447               ------------------------------DGLILALGMDDRK------QQLPNGSLLIQ
                                                                                             
  
  
  WP:CE26976/1-4280              QIEAYTTSGGIESWEEKPQVVDQGKQQFAVHWKLPTTSITVSKFILEYRLPNETTWRTSE
  PP:PP48100/1-3609              SIDTTTGTQPVKDLEQDMTVTEDGDSMYSVHWSLP-AHLTADHFVVEYRLPNETVNIGSG
  SRP:SRP08301/1-1589            GAI-----LEDEGSYQCVVHVTDEHSNL---WSFISKKGNIFLLQTIIKFASQPKSQ---
  OV:OVP04334/1-1751             NVG-----SPDEGLYQCAVHVTDKNNFV---WTYLSRRATV-RLPFLSRFEIQPEDR---
  BM:BM45234/1-1465              NVG-----SSDEGLYQCVVHVTDKKSFV---WTYLSRRAAV-RLPSLSRFEIQPEDR---
  CN:CN16484/1-1420              SMS-----STEEGAYQCAVHVTTKGNSIDDTWIFLSKKATV-RVADLAKFDLQPTDR---
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              SVS-----SAEEGTYQCAVHVTTKSDQTSDTWTFLSRKATL-RLADLAKFELQAIDR---
  RP:RP26668/1-1432              SMS-----SAEEGTYQCAVHVSTKNELTISTWTFLSRKATL-RLADLAKFDLQPVDR---
  BP:CBP38503/1-1487             AMS-----SAEEGTYQCAVHVTSKNDLAIDTWTFLSRKATL-RLADLSKFELQPVDR---
  FLYBASE:CG8581/1-1526          SVE---ENRGLTGAYQCLLTAEGVG-------SILSRPALV-AIVRQPDLNQDFLET---
  ENSEMBL:ENSP00000389140/1-1447 NILHSRHHKPDEGLYQCEASLGDSG-------SIISRTAKV-AVAGPLRFLSQTESV---
  SW:P70211/1-1447               NILHSRHHKPDEGLYQCEASLADSG-------SIISRTAKV-TVAGPLRFLSQTESI---
                                                                                             
  
  
  WP:CE26976/1-4280              QKGVADESGDYSVALSQM-NAPYYTVRIVAIDDQNKVVARTEELTVGEAAETSCIGSAGV
  PP:PP48100/1-3609              HQ--------FKSSLHNLASVSVFGVRLTAVDKDGNALARTDETTVGKAASTSCLGLAGL
  SRP:SRP08301/1-1589            ------------------------------------------TVFEGNSAVFECQ-----
  OV:OVP04334/1-1751             ------------------------------------------EVHVGQSVAFACK-----
  BM:BM45234/1-1465              ------------------------------------------EVHVGQSVAFACI-----
  CN:CN16484/1-1420              ------------------------------------------TVTKGQPTAFHCL-----
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------TLAKGQPTAFHCL-----
  RP:RP26668/1-1432              ------------------------------------------TIAKGQPTAFHCL-----
  BP:CBP38503/1-1487             ------------------------------------------TVAKGQPTAFHCL-----
  FLYBASE:CG8581/1-1526          ------------------------------------------YLLPGQTAYFRCM-----
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------TAFMGDTVLLKCE-----
  SW:P70211/1-1447               ------------------------------------------TAFMGDTVLLKCE-----
                                                                                             
  
  
  WP:CE26976/1-4280              PTNIRSAD-VDGQSIKLEWDVPRCDETHTP-IDGYEYIVYEASQSAPVDGASYVGAPHVI
  PP:PP48100/1-3609              PTEVSATP-TGTGTIYFSWRKPDCDETAAP-IDGYEYMLWDSSSTPP-QTASYIGNTAVT
  SRP:SRP08301/1-1589            -----LRPSEILFHPSVSWYYNGK----VIEVTNNDYKIVPETNTLE-------------
  OV:OVP04334/1-1751             ---LDSQP-----SAHIEWFFNGK---RINDRDDSSITIFPITSTLE-------------
  BM:BM45234/1-1465              ---LDSQP-----SAHIEWFFNGK---RISGRDDSSLTIFPVTSTLE-------------
  CN:CN16484/1-1420              ---INSKR-----TPSAVWLHNDQ-----QITNGGEYHILPLSNTLE-------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ---INSKP-----TPTAVWLHNDE-----PIVNGGEYHILPVSNTLE-------------
  RP:RP26668/1-1432              ---INSKP-----TPLAVWLHNDQ-----PITNGGEYHILPVSNTLE-------------
  BP:CBP38503/1-1487             ---INSKP-----TPSAVWLHNDQ-----PIVNGGEYHILPVSNTLE-------------
  FLYBASE:CG8581/1-1526          ---LGEANWQEGVKHSVQWLKDDL---PLP-LDKLRMVVLP-NGALE-------------
  ENSEMBL:ENSP00000389140/1-1447 ---VIGEP-----MPTIHWQKNQQDLTPIP--GDSRVVVLP-SGALQ-------------
  SW:P70211/1-1447               ---VIGEP-----MPTIHWQKNQQDLNPLP--GDSRVVVLP-SGALQ-------------
                                                                                             
  
  
  WP:CE26976/1-4280              IKGLKQNVDYTFKVRSRSVNGHSQWSKDVIIETAVAGSVRSGELGEPNQLLRVKRQAKHL
  PP:PP48100/1-3609              RDGLLPNKAYSFKVRSRSGNGHSVWSSLVEAETT-ASSVNAAQTGAAA------------
  SRP:SRP08301/1-1589            IQSVKKTHQGSYYCIISYD-----------------------------------------
  OV:OVP04334/1-1751             IISVLPKHGGAYRCVATNE-----------------------------------------
  BM:BM45234/1-1465              ISSVLPKHEGAYRCVATNE-----------------------------------------
  CN:CN16484/1-1420              ISSTQPRHEGTYRCTVEGA-----------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ISSTQSRHEGTYRCTVEGA-----------------------------------------
  RP:RP26668/1-1432              ISSTQSRHEGTYRCTVEGA-----------------------------------------
  BP:CBP38503/1-1487             ISSVQSRHEGTYRCTVEGA-----------------------------------------
  FLYBASE:CG8581/1-1526          IDEVGPSDRGSYQCNVTSG-----------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ISRLQPGDIGIYRCSARNP-----------------------------------------
  SW:P70211/1-1447               ISRLQPGDSGVYRCSARNP-----------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              IKDSLNIFKLRIVLSPPCSFLVWTPLTQHSQIISKFKLMYKEVSSSKWIKLIGGMDHFRC
  PP:PP48100/1-3609              ---------------------------------------------------IG-------
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              PPGIADPEDYCYQLKGLFFGVHYISSISYKLTNGEELPSSNPLHFTLVQLDGSAAPSNER
  PP:PP48100/1-3609              ------------------------------------------------------------
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              VTLTQPRIEQSASRSVAYWSVVGDRAAV-TEYQVDIRSTDERSWRAVEPSVQNEQSQTHY
  PP:PP48100/1-3609              LQLSQPRIEQQGALTVVYWTSQGYSTTV-NSYQVEIRKETEADWRKAGAVIRNDPSKTHY
  SRP:SRP08301/1-1589            ---GFEKKSEIGILTSKED-TSSKNDNE-LSMSLS-------------------------
  OV:OVP04334/1-1751             ---GKTRSSRDAQLTIKPENSVGNEFSE-PYFVLE-------------------------
  BM:BM45234/1-1465              ---GKTRASRDAQLTIKPENSVGNEFSE-PNFILE-------------------------
  CN:CN16484/1-1420              ---GKRRSSQTARLTV----STGDVSNE-LSFITT-------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ---GKRRSSQTARLTV----TTETVSNE-LVFITT-------------------------
  RP:RP26668/1-1432              ---GKRRSSQTARLTV----TTGDTSNE-LSFITT-------------------------
  BP:CBP38503/1-1487             ---GKRRSSQTARLAV----TIGEVSNE-LSFITT-------------------------
  FLYBASE:CG8581/1-1526          ---SSSRLSSKTNLNIKKPSDPGAENSVAPSFLVG-------------------------
  ENSEMBL:ENSP00000389140/1-1447 ---ASSRTGNEAEVRIL---SDPGLHRQ-LYFLQR-------------------------
  SW:P70211/1-1447               ---ASIRTGNEAEVRIL---SDPGLHRQ-LYFLQR-------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              RLPLGQLNVASTYLVRVRALDSSRATVATSPSASFSVLCQVPSAPENVRLERVSEQLVRA
  PP:PP48100/1-3609              RESLGNLPVSPLYYIRVRAQDSSMTTVATSSAASFSVNCHVPLSPDNVRVERVSAETVRV
  SRP:SRP08301/1-1589            ----------------------PPSEIDVILGEKFVLPCLS-------------------
  OV:OVP04334/1-1751             ----------------------PRGDV-INEGGSVVLECLV-------------------
  BM:BM45234/1-1465              ----------------------PRGDV-VNEGGSVVLECLV-------------------
  CN:CN16484/1-1420              ----------------------PRLQV-VDQGDEFLLECLV-------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ----------------------PRLQV-VEQGDEFLLECLV-------------------
  RP:RP26668/1-1432              ----------------------PRLQV-VENGDEFLLECLV-------------------
  BP:CBP38503/1-1487             ----------------------PRLQV-VEQGGEFLLECLV-------------------
  FLYBASE:CG8581/1-1526          ----------------------PSPKT-VREGDTVTLDCVA-------------------
  ENSEMBL:ENSP00000389140/1-1447 ----------------------PSNVV-AIEGKDAVLECCV-------------------
  SW:P70211/1-1447               ----------------------PSNVI-AIEGKDAVLECCV-------------------
                                                                                             
  
  
  WP:CE26976/1-4280              AWDSSQESGDCQSYFFITGQQNGQAINQRVPGSDRSVDIAGSSQGDWRVQVRGVNTAGSG
  PP:PP48100/1-3609              SWSAPADDDACQPFFTVSGTIDGRQLQRRVPGFERSVEIDGSGK-DYVLEVRMVNIDGSG
  SRP:SRP08301/1-1589            ----------------------------------------------------------SK
  OV:OVP04334/1-1751             ----------------------------------------------------------NG
  BM:BM45234/1-1465              ----------------------------------------------------------NG
  CN:CN16484/1-1420              ----------------------------------------------------------AS
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ----------------------------------------------------------AS
  RP:RP26668/1-1432              ----------------------------------------------------------AS
  BP:CBP38503/1-1487             ----------------------------------------------------------AS
  FLYBASE:CG8581/1-1526          ----------------------------------------------------------NG
  ENSEMBL:ENSP00000389140/1-1447 ----------------------------------------------------------SG
  SW:P70211/1-1447               ----------------------------------------------------------SG
                                                                                             
  
  
  WP:CE26976/1-4280              TPSRDAIFASSAQQSRRSKRSVCDPRTDFWCKGEFSNSPLREPDSGEA------------
  PP:PP48100/1-3609              PASAQTRLIGN-ERSFRLKRSVCDPVRDFWCDGYGNNQQLNLGPAGTGNLRRVQSSCGGA
  SRP:SRP08301/1-1589            PSTTIVK----------------------WINGSSSNNNIILQ--NN-------------
  OV:OVP04334/1-1751             WPRPDVR----------------------WLKGA---ETISIT--GD-------------
  BM:BM45234/1-1465              WPRPNVR----------------------WLKGA---ETISLT--GD-------------
  CN:CN16484/1-1420              RIRPQIR----------------------WLKDS---RQIIVD--GT-------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              LIRPQVR----------------------WLKDS---RQIIVD--GV-------------
  RP:RP26668/1-1432              RIRPQVR----------------------WLKDS---RQIIVD--GV-------------
  BP:CBP38503/1-1487             RIRPQVR----------------------WLKDS---RQIIVD--GV-------------
  FLYBASE:CG8581/1-1526          VPKPQIK----------------------WLRNG---MDLDFNDLDS-------------
  ENSEMBL:ENSP00000389140/1-1447 YPPPSFT----------------------WLRGE---EVIQLR--SK-------------
  SW:P70211/1-1447               YPPPSFT----------------------WLRGE---EVIQLR--SK-------------
                                                                                             
  
  
  WP:CE26976/1-4280              -----LCSTPRVLAQENDLIVKWKSEGDGRGVYGYHVQFRNENSGWKTYGQLVPYVRDNM
  PP:PP48100/1-3609              VRACPLCSTPRVSARNGDLVVEWRSEGDGRGVHGYRIQYRTDQSGWNPYGQLVPYVGDEK
  SRP:SRP08301/1-1589            ----------RIKQVGHSSLLIEKAEIFDNGIYTCQVTSSKDV-----------------
  OV:OVP04334/1-1751             ----------RMRQLGSSSFMILNAKAQDTGVYTCRA-----------------------
  BM:BM45234/1-1465              ----------RMRQLGSSSFMILKAKAVDTGVYTCRASNSQES-----------------
  CN:CN16484/1-1420              ----------RIRRIGVSSILVSRASIEDTGLYTCRASNNDDS-----------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ----------RIRRVGVSSILVSRASIEDTGLYTCRASNNDDS-----------------
  RP:RP26668/1-1432              ----------RIRRVGVSSIVVSRASIEDTGLYTCRASNNDDS-----------------
  BP:CBP38503/1-1487             ----------RIRRVGVSSILVSRSSIEDTGLYTCRASNNDDS-----------------
  FLYBASE:CG8581/1-1526          ----------RFSIVGTGSLQISSAEDIDSGNYQCRASNTVDS-----------------
  ENSEMBL:ENSP00000389140/1-1447 ----------KYSLLGGSNLLISNVTDDDSGMYTCVVTYKNEN-----------------
  SW:P70211/1-1447               ----------KYSLLGGSNLLISNVTDDDSGTYTCVVTYKNEN-----------------
                                                                                             
  
  
  WP:CE26976/1-4280              EYTQTLTGLERGHAYFIHVQVLDRNSYVMYTSAQSSAKSSCSPPTHTPSHLQVAAPDASH
  PP:PP48100/1-3609              EYSQTLTGLQRGHNYYMHIQVLDRNSYVMYTSPEASATSACSAPTQAPSHIAVEAPDASH
  SRP:SRP08301/1-1589            ---------------------IEKSTRVNVRRKPEIIKPLHNQIAQETKDIEINCAV---
  OV:OVP04334/1-1751             -------------------------------IAPEIISEPNSVVAQETMDVEFNCEA---
  BM:BM45234/1-1465              ---------------------LDASATVQVKVAPKIISEPNNVVAQETMDVEFNCEA---
  CN:CN16484/1-1420              ---------------------VDRAVAVEVRAPPKITTRPATKVAVETADVEFECGTA--
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ---------------------IDRAVSVEVRAPPRITTRPTTKVAVETADVELECGTA--
  RP:RP26668/1-1432              ---------------------IDRAVSVEVRAPPRITTKPVTKVAVETADVELECGTA--
  BP:CBP38503/1-1487             ---------------------IDRAVSVEVRAPPRITTRPATKVAVETADVELECGTA--
  FLYBASE:CG8581/1-1526          ---------------------LDAQATVQVQEPPKFIKAPKDTTAHEKDEPELKCDI---
  ENSEMBL:ENSP00000389140/1-1447 ---------------------ISASAELTVLVPPWFLNHPSNLYAYESMDIEFECTV---
  SW:P70211/1-1447               ---------------------ISASAELTVLVPPWFLNHPSNLYAYESMDIEFECAV---
                                                                                             
  
  
  WP:CE26976/1-4280              VRVQWALP-PQSTWGCSDIQFEIQPEEPRG---QPAVVLGSHQTSHIFNSAPNQMWSVKI
  PP:PP48100/1-3609              VRVTWALP-PQSGWGCADITFEIQVEEPRGLHPSPQRVAGG-STSHVFVAHPGQQWTIRM
  SRP:SRP08301/1-1589            ----ESFPKSKITW-----------------YKNGEPIIPS---EYFVVINYNNLKVLGL
  OV:OVP04334/1-1751             ----SGEPGPTISW-----------------YKNGETIIAS----EYFMIEATRLRVLGL
  BM:BM45234/1-1465              ----SGEPGPSISW-----------------YKNGEAIIAS----EYFVIEATRLRVLGL
  CN:CN16484/1-1420              ----SARPEARVNW-----------------YKNGEAIIGS----EYFVIEPNRLRILGV
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ----AARPEARVNW-----------------YKNGEAIIGS----EYFVIEPNRLRILGV
  RP:RP26668/1-1432              ----SARPEARVNW-----------------YKNGEAIIGS----EYFVIEPNRLRILGV
  BP:CBP38503/1-1487             ----AARPEARVSW-----------------YKNGEAIIGS----EYFVIEPSRLRILGV
  FLYBASE:CG8581/1-1526          ----WGKPKPVIRW-----------------LKNGDLITPN---DYMQLVDGHNLKILGL
  ENSEMBL:ENSP00000389140/1-1447 ----SGKPVPTVNW-----------------MKNGDVVIPS---DYFQIVGGSNLRILGV
  SW:P70211/1-1447               ----SGKPVPTVNW-----------------MKNGDVVIPS---DYFQIVGGSNLRILGV
                                                                                             
  
  
  WP:CE26976/1-4280              RAINSAGHSAWTPAAQTKTPPGGELIIGPDVSYRQGKPIISWRSKENTNDLIESFVLEWK
  PP:PP48100/1-3609              RTVNSAGHSAWTAPATVKTPAAGEAIVSPTVSHRQGVPTVMWQSKESHDDLIESFILEWR
  SRP:SRP08301/1-1589            VKDDQGVYQCLAENDIGSVESHSQIMIDTP------------------------------
  OV:OVP04334/1-1751             VRNDQGVYQCIAENDAGSVQSNAQLIVDSSEELLQLYALKFYSMNETTSVLEEML-----
  BM:BM45234/1-1465              VRNDQGVYQCIAENDAGSVQSNAQLIVDSS------------------------------
  CN:CN16484/1-1420              VRADQAVYQCLAENDVGSEQANAQLLVDAP------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              VRADQAIYQCIAENDVGSEQASAQLLVDAP------------------------------
  RP:RP26668/1-1432              VRADQAIYQCIAENDVGSEQASAQLLVDAP------------------------------
  BP:CBP38503/1-1487             VRADQAIYQCIAENDVGSEQASAQLLVDAP------------------------------
  FLYBASE:CG8581/1-1526          LNSDAGMFQCVGTNAAGSVHAAARLRVVPQGVKIKKRKSQGHSTKSLQTFDNLTKRRKPF
  ENSEMBL:ENSP00000389140/1-1447 VKSDEGFYQCVAENEAGNAQTSAQLIVPKP------------------------------
  SW:P70211/1-1447               VKSDEGFYQCVAENEAGNAQSSAQLIVPKP------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              STTESSWRQHRNPIPYNGWQRPYSVDLGELPQGHTYQVRIVAKDPNRGNAYTSPVVQVQT
  PP:PP48100/1-3609              EQGEENWRQHTNALPYTGWQRPYSMDLGALPKGKTYVVRIIAKDHNRANAFVSPSITIQT
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          NSGEQLRTKSGGSFPFPDEDDDLDDNDSGTTRLRIPSGKLPKFEQPLNDRRFNILNAGSA
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              QSQCKAPRRAPADVQVSPLGPTQIRVQWAPLHESEWNCDRLWYIVKHSTPQNQGFKNLTN
  PP:PP48100/1-3609              EQQCTPPRRAPTNLQVAPLGPTQIRLTWAPLHESEWGCDRLWYLVKYATARNSGTRNLTA
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          LPLDNQSKSYEDDDDDYDEDDPAKEALLEAYKQGEDAHKILDSWQQSKSKKSQQQKQ---
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              GENFVVFDSDPYTQWNFEVQAANPAGESQWSRAQSAQTQGV-------APGAVANLRVQP
  PP:PP48100/1-3609              GENSVVFDSDPFTKWTFEVKSANPAGESQWSRAQSSQTQDA-------APGPVSGLRVSA
  SRP:SRP08301/1-1589            ---------------------------ASLLALAASSGHPK-------KPGKPSGLKSVN
  OV:OVP04334/1-1751             -----------------------NFNNTDSFSMAASSGQPK-------LPSEPLGVRANV
  BM:BM45234/1-1465              ----------------------------DSFSMAASSGQPK-------LPSEPLGVRASV
  CN:CN16484/1-1420              ----------------------------DSSSVAASSGVPM-------TASAPLGLRSTS
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ----------------------------DSSSVAASSGVPM-------TSSAPLGLRSTS
  RP:RP26668/1-1432              ----------------------------DSSSVAASSGVPM-------TASAPLGLRSTS
  BP:CBP38503/1-1487             ----------------------------DSSSVAASSGVPM-------TASAPLGLRSTS
  FLYBASE:CG8581/1-1526          -------------------SPASPDSPEQDPSVPHPGGKPLDSGLQARLPSQPRDLVAQI
  ENSEMBL:ENSP00000389140/1-1447 ----------------------------------AIPSSSV-------LPSAPRDVVPVL
  SW:P70211/1-1447               ----------------------------------AIPSSSI-------LPSAPRDVLPVL
                                                                                             
  
  
  WP:CE26976/1-4280              IGPDSLQCSWQPPVNPNGRITQYEVTYQLISRGNCDNNQE----------------APRT
  PP:PP48100/1-3609              IGSDSLQLSWTPPAQPNGHVTSYEITYQLTSKGMCEEVRE----------------QPRT
  SRP:SRP08301/1-1589            IGSRFIELTWDLPTGNNKDIVRYHIMYK-------EVGQN----------------RERT
  OV:OVP04334/1-1751             VGSRFVVLTWDPPVQRHGAVLAYHIFYK-------EQDSS----------------RERM
  BM:BM45234/1-1465              VGSRFVVLTWDPPVQRHGAVLAYHIFYK-------EQDSL----------------RERM
  CN:CN16484/1-1420              SGSRFITVEWDPPVLRNGNIMRYHVFYK-------DNMID----------------RERM
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              SGSRFINVEWDPPVQRNGNIMRYHIFYK-------DNLID----------------RERM
  RP:RP26668/1-1432              SGSRFINVEWDPPVQRNGNIMRYHVFYK-------DNLIDRYYNTSLKVLYIYICFRERM
  BP:CBP38503/1-1487             SGSRFINVEWDPPVQRNGNIMRYHVFYK-------DNSID----------------RERM
  FLYBASE:CG8581/1-1526          VKSRFVTLSWVEPLQNAGDVVYYTVYYK-------MNNSE----------------REQK
  ENSEMBL:ENSP00000389140/1-1447 VSSRFVRLSWRPPAEAKGNIQTFTVFFS-------REGDN----------------RERA
  SW:P70211/1-1447               VSSRFVRLSWRPPAEAKGNIQTFTVFFS-------REGDN----------------RERA
                                                                                             
  
  
  WP:CE26976/1-4280              ITVNGPHFTITGLHPHSKYRVGVAAKSNVGAGERVSLEIQTDQAAPSGAPLYLRTEDIRP
  PP:PP48100/1-3609              VSADRTSFVLTGLQPHSRYRVGVAAKTTM-AGERVAQEAQTEQSVPTAAPTYTRIEETTE
  SRP:SRP08301/1-1589            LNTSLTN-----------------------------------------------------
  OV:OVP04334/1-1751             LNSSATS-----------------------------------------------------
  BM:BM45234/1-1465              LNSTAAS-----------------------------------------------------
  CN:CN16484/1-1420              VNSSSPS-----------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              INSSSTS-----------------------------------------------------
  RP:RP26668/1-1432              INSSSTS-----------------------------------------------------
  BP:CBP38503/1-1487             INSSSTS-----------------------------------------------------
  FLYBASE:CG8581/1-1526          MVTKSHD-----------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 LNTTQPG-----------------------------------------------------
  SW:P70211/1-1447               LNTTQPG-----------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              TDVSISWQAPPCLQTNGEITEYEYEVTAGDRRQTVQKTTENIRG-TRAKIENLQPQTRYN
  PP:PP48100/1-3609              SEAAVSWQAPPCLQTHGEITEYEFEAVPLDKR--YPPNTNTVRGSTRTRITGLLPGTDYN
  SRP:SRP08301/1-1589            -----------------------------------------------IVVNGLSAEATYT
  OV:OVP04334/1-1751             -----------------------------------------------FTVTPLQPNTTYV
  BM:BM45234/1-1465              -----------------------------------------------FTVTPLQPNTTYV
  CN:CN16484/1-1420              -----------------------------------------------VTLTSLQPSTMYL
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              -----------------------------------------------ATLTSLQPSTMYL
  RP:RP26668/1-1432              -----------------------------------------------ATLTSLQPSTMYL
  BP:CBP38503/1-1487             -----------------------------------------------ATLTSLQPFTMYL
  FLYBASE:CG8581/1-1526          --------------------------------------------DQQVNIQSLLPGRTYQ
  ENSEMBL:ENSP00000389140/1-1447 --------------------------------------------SLQLTVGNLKPEAMYT
  SW:P70211/1-1447               --------------------------------------------SLQLTVGNLKPEAMYT
                                                                                             
  
  
  WP:CE26976/1-4280              VKVRAYTARGAGPWSTEVPFQTSAGQQNVQAPGFVKVLHTGADNAQLVWQS-PYPNPGYV
  PP:PP48100/1-3609              LRVRAFTTKGPGPWSHPTRFQTAAAAAS-SVPPLVKVVGTGADSAHLLWHSPPSGQPDQY
  SRP:SRP08301/1-1589            FTVSAENYAGIGEASKPL------------------------------------------
  OV:OVP04334/1-1751             FRLVAENEAGMGKSSTRI------------------------------------------
  BM:BM45234/1-1465              FRLAAENEAGMGKSSTRI------------------------------------------
  CN:CN16484/1-1420              IRVTAENEAGMGKFSDSL------------------------------------------
  JA:JA57681/1-866               ----------MGKFSDSI------------------------------------------
  WP:CE25115/1-1415              IRVTAENEAGMGKFSDSL------------------------------------------
  RP:RP26668/1-1432              IRVTAENEAGMGKFSDSL------------------------------------------
  BP:CBP38503/1-1487             IRVTAENEAGMGKFSDSL------------------------------------------
  FLYBASE:CG8581/1-1526          FRVEANTNFGSGASSAPL------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 FRVVAYNEWGPGESSQPI------------------------------------------
  SW:P70211/1-1447               FRVVAYNEWGPGESSQPI------------------------------------------
                                            *  *                                             
  
  
  WP:CE26976/1-4280              DKYKCRYAPSGTQQYQERQFPAVSPCQQRQIERQNLPQSPPGSRLHCGRIENLRPEQTYD
  PP:PP48100/1-3609              NKFKCRYGITGQQQRQEQVFPAQSPCSQELIRRQQVPPPPPGSRMHCGRIDRLQQNQTYD
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              FQVSAHVKDSGWGPYSPPERTKVTESAVQVLFVKKIGGSENSLHINWDVRPDDKNRVTAF
  PP:PP48100/1-3609              FQVSACQRNNKCSPYSPPERSRITEGPVGVETVYKISGTDKSLTVGWRVRPDDVSRVTAF
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              RITVVPQDGSQRSQTFNVDRATYQYRIDNLRPRTTYNVTVSAATHKEMCGGTAAVMTTDA
  PP:PP48100/1-3609              KLHIMPTDGRSHPQTFSLDRSTYQYRIDNLSPSTHYNVTVQASTNREWCGGTSTLMATDA
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              AALTALSTAPRVIAEEPTSITIEWESRNREAGGFIVEYRLEGGAWQQYARRIPAHPSQTT
  PP:PP48100/1-3609              EALTAISGAPRVIAEMPTSVTISWDNHNRNAGSFIIEYKVDGGAWTEHPRRVQARPGQTT
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              YTATVDGLPTNAVVDLRVRVVSQQNEQSNPSPEVRARTKCSPPTSPPQGVRVDAPSTNEV
  PP:PP48100/1-3609              YEGIVDGLPTNTVVDLRVKVVSTRNEHSPPSPEARARTKCSPPATPPQGIRVDSPTPSEV
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              RVSWARPAKNTWMCDQMNVEISYRVGNQPEKVLTVPGDQTEYTFPAEPNQRWVVKLRATN
  PP:PP48100/1-3609              RVSWARPAKDSWMCDQLNIEIAYKVGNQPEKVVPVPGEVTDYTFPAEPNQRWVIKLRATN
  SRP:SRP08301/1-1589            -----------------------VITTEKEDLV---------------------------
  OV:OVP04334/1-1751             -----------------------FVTTTEEKAV---------------------------
  BM:BM45234/1-1465              -----------------------LITTAEEKAV---------------------------
  CN:CN16484/1-1420              -----------------------KVTTNKEQAV---------------------------
  JA:JA57681/1-866               -----------------------KVTTNKEQAV---------------------------
  WP:CE25115/1-1415              -----------------------KVTTNKEQAV---------------------------
  RP:RP26668/1-1432              -----------------------KVTTNKEQAV---------------------------
  BP:CBP38503/1-1487             -----------------------KVTTNKEQAV---------------------------
  FLYBASE:CG8581/1-1526          -----------------------EVSTQPEVNI---------------------------
  ENSEMBL:ENSP00000389140/1-1447 -----------------------KVATQPELQV---------------------------
  SW:P70211/1-1447               -----------------------KVATQPELQV---------------------------
                                                         : .  *  :                           
  
  
  WP:CE26976/1-4280              QVGSSQWSPEQSITTRQGAPGSVRDLRVKALSPNEVHVQWLAPLVQRGTIVGYDISYRLK
  PP:PP48100/1-3609              QMGSSPYSPEYTITTRQGMPGAVRDLRVKALGPNEVRVNWLPPAEARGQIVGYDISYRLK
  SRP:SRP08301/1-1589            -------------------PGKVRNLVAKASDSESIDVSWDPPLTGGGN------TNVSH
  OV:OVP04334/1-1751             -------------------PGKVKNLHGIALSPETVEVLWEPP--GGNG------PEPVQ
  BM:BM45234/1-1465              -------------------PGKVKNLRGTALSPETVEVSWEPP--GGNG------PEPVQ
  CN:CN16484/1-1420              -------------------PGKVAPLVATATGPETIQIRWSPP--AGGQ------P-ALR
  JA:JA57681/1-866               -------------------PGKVNALTATATGPETIDIRWSPP--SGGQ------P-ALR
  WP:CE25115/1-1415              -------------------PGKVASLTTTATGPETIDIRWSPP--SGGQ------P-ALR
  RP:RP26668/1-1432              -------------------PGKVTSLTATATGPETIDIRWSPP--SGGQ------P-ALR
  BP:CBP38503/1-1487             -------------------PGKVTSLVATATGPETIDIRWSPP--SGGQ------P-ALR
  FLYBASE:CG8581/1-1526          -------------------AGPPRNFEGYARSHKEIYVKWEEPTVTNGE--------ILK
  ENSEMBL:ENSP00000389140/1-1447 -------------------PGPVENLQAVSTSPTSILITWEPPAYANGP--------VQG
  SW:P70211/1-1447               -------------------PGPVENLHAVSTSPTSILITWEPPAYANGP--------VQG
                                                    .*    :   : .   : : *  *    .            
  
  
  WP:CE26976/1-4280              HRLACPEEEPRDVSRDFVTVYNHKDLDYTITGLLPYSLYEVRVRARTTELGP---EETKE
  PP:PP48100/1-3609              HRLACPEEEPRDVSRDFVTVYNHKDVDYTLTGLLPYSLYEVKVRARTTELGP---EETKE
  SRP:SRP08301/1-1589            YNLFYSKKD---EDRE--TRIPMIKTFHTLHGLSKNTEYKIRVETEGKN-GVGKSSDILF
  OV:OVP04334/1-1751             YKLFYIRKDHEPNEKE--TQIVVKKTSYTLHGMEKYVEYIIRVEAEGVN-GAGLSSEPIT
  BM:BM45234/1-1465              YKLFYIRKDHEVNEKE--TQIVMKKTSYTLHGMEKYVEYIIRVEAEGVN-GAGLSSEPIT
  CN:CN16484/1-1420              YKIFYSHDPPEKNEKE--TLITTSTTHYVLHGMDKYTGYQIRIEAEGTN-GSGLSSDIVR
  JA:JA57681/1-866               YKIFYSHDPLEKNEKE--TLITTSTTHYTLHGMDKYSGYQIRIEAEGAN-GSGLTSDTVK
  WP:CE25115/1-1415              YKIFYSHDPLEKNEKE--TLITTSTTHYTLHGMDKYTGYQIRIEAEGSN-GSGLSSDTVK
  RP:RP26668/1-1432              YKIYYSHDPLEKNEKE--TLITTSTTHYTLHGMDKYTGYQIRIEAEGSN-GSGLSSDTVR
  BP:CBP38503/1-1487             YKIYYSHDPLEKSEKE--TLITTSTTHYTLHGMDKYTGYQIRIEAEGAN-GSGLSSDTVR
  FLYBASE:CG8581/1-1526          YRVYYSEND---SGAD--LYHDSTALEAVLTELRPHTDYVISVVPFNRN-GMGDSSAEIR
  ENSEMBL:ENSP00000389140/1-1447 YRLFCTEVS---TGKE--QNIEVDGLSYKLEGLKKFTEYSLRFLAYNRY-GPGVSTDDIT
  SW:P70211/1-1447               YRLFCTEVS---TGKE--QNIEVDGLSYKLEGLKKFTEYTLRFLAYNRY-GPGVSTDDIT
                                 :.:   .        :             :  :     * : . .     *         
  
  
  WP:CE26976/1-4280              VSTEQQPPSSPPLNLESTYALERSLSFQWEPVDCSQRHGHVVNYEYEILGQDDWAKLERQ
  PP:PP48100/1-3609              VATEQQPPSAPPINLQLSYALERSLSFQWEPVECSQRHGHITNYEYEIVGQDDWAKLERQ
  SRP:SRP08301/1-1589            VKTLSDVPSGKPYNIKVINKMADSLLVSWIGPKEDEKNGDITGYIIKYKAKKKNSKLKSV
  OV:OVP04334/1-1751             IRTLSDLPSLPPSDVRAEAISTTSIHVQWMPLPIEDRNGILTGYRIKYKTKLRGTKGNTL
  BM:BM45234/1-1465              VRTLSDLPSLPPSDVRAEAISTTSILVQWMPLSAEDRNGILTGYRIKYKTKLRGAKSNTL
  CN:CN16484/1-1420              VRTLSDEPSSPPTNIRAEADSSTSVRVSWEEPEENSVNGEITGYRLKYKTKARGAKGNML
  JA:JA57681/1-866               VRTQSDEPEAPPVSIQAEADSSTSIRVSWDQPADETVNGEITGYRLKYKTKARGAKGNTL
  WP:CE25115/1-1415              VRTQSDEPSAPPVNIQAEADSSTSVRVSWDEPEEESVNGEITGYRLKYKTKARGAKGNTL
  RP:RP26668/1-1432              VRTQSDEPSAPPVNIQAEADSSTSVRVSWDEPEEESVNGEITGYRLKYKTKARGAKGNTL
  BP:CBP38503/1-1487             IRTQSDEPSAPPVNIQAEADSSTSVRVSWDEPEKYSVNGEVTGYRLKYKTKARGAKGNTL
  FLYBASE:CG8581/1-1526          VKTFSSTPSEPPNNVTLEVTSSSSITVHWEPPAEEDRNGQITGYKIRYRKFKDAPQVKS-
  ENSEMBL:ENSP00000389140/1-1447 VVTLSDVPSAPPQNVSLEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTTR--RGEME
  SW:P70211/1-1447               VVTLSDVPSAPPQNISLEVVNSRSIKVSWLPPPSGTQNGFITGYKIRHRKTTR--RGEME
                                 : * .. *.  * .:        *: . *        :* :..*  .        : :  
  
  
  WP:CE26976/1-4280              IANTSDLRVTIDGLTPYTKYVMRVKAYNSIGGGPNTENLVVMTAKAQAPLPPQDLVVAQE
  PP:PP48100/1-3609              ISNTSNPKITIDGLTPYTKY-----AYNSIGGGPNTENLDVRTAKADAPLPPQDLVVAQE
  SRP:SRP08301/1-1589            FVKGNVQKFELTRLEGGTQYSIRIAAINSNGTGPYS------------------------
  OV:OVP04334/1-1751             VVDGNNSSYTISGLEPGTQYMLRVAAVNQNGSGPNS------------------------
  BM:BM45234/1-1465              VIDGNNSSYIISGLEPGTQYMLRVAAINQNGSGPNS------------------------
  CN:CN16484/1-1420              VIDATAQEYTMGNLEPNTQYLIRMAVVNHNGTGPFS------------------------
  JA:JA57681/1-866               VIDATARDYTMGNLEPSTQYLVRMAVVNHNGTGPFS------------------------
  WP:CE25115/1-1415              VIDATAREYTMGNLEPNTQYLIRMAVVNHNGTGPFS------------------------
  RP:RP26668/1-1432              VIDATAREYTMGNLDSNTQYLIRMAVVNHNGTGPFS------------------------
  BP:CBP38503/1-1487             VIDATSREYTMGNLEPNTQYLIRMAVVNHNGTGPFS------------------------
  FLYBASE:CG8581/1-1526          -TPANIRYFELSNLDRNAEYQVKIAAMTVNGSGPFT------------------------
  ENSEMBL:ENSP00000389140/1-1447 TLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPS------------------------
  SW:P70211/1-1447               TLEPNNLWYLFTGLEKGSQYSFQVSAMTVNGTGPPS------------------------
                                     .     :  *   ::*     . .  * ** :                        
  
  
  WP:CE26976/1-4280              GTSFFMVSWLPPYPPYGPHDAYKIRYQQIPSDDWKEVEKGIKDPLLQCPGESPRFCYNAT
  PP:PP48100/1-3609              GTEFFMVSWLPPYPPYGPHSHYKLRYQLLGTDGWNEVEKHVEDPLIACPGESPRFCYNVT
  SRP:SRP08301/1-1589            --------------------------------EAIHAE---------TTFE---------
  OV:OVP04334/1-1751             --------------------------------DWFHVD---------TPLE---------
  BM:BM45234/1-1465              --------------------------------DWFHVD---------TPLE---------
  CN:CN16484/1-1420              --------------------------------DWVTVD---------TPGQ---------
  JA:JA57681/1-866               --------------------------------DWVAVD---------TPGQ---------
  WP:CE25115/1-1415              --------------------------------DWVSID---------TPGQ---------
  RP:RP26668/1-1432              --------------------------------DWVAVD---------TPGQ---------
  BP:CBP38503/1-1487             --------------------------------EWVAVD---------TPGQ---------
  FLYBASE:CG8581/1-1526          --------------------------------EWNRAN---------TLEN---------
  ENSEMBL:ENSP00000389140/1-1447 --------------------------------NWYTAE---------TPEN---------
  SW:P70211/1-1447               --------------------------------NWYTAE---------TPEN---------
                                                                      :            :         
  
  
  WP:CE26976/1-4280              GLDSGQQFKIQVATRIEGGSYGPWSSLVIANTLQVLPDAPRAIHLIEKTDHSLHIRWVPP
  PP:PP48100/1-3609              ELDPGRQYKVQVSCKIEEGSYGPWSSIVIANTLQVLPDAPRAIELIERTDHSLHIRWLPP
  SRP:SRP08301/1-1589            ERDENR-----------------------------IAGAPIELKVIPSHDR-IKVSWQAP
  OV:OVP04334/1-1751             DKDEGQ-----------------------------VAGPPLSLKVQPSVDS-IQLSWLPP
  BM:BM45234/1-1465              DKDEGQ-----------------------------VAGPPLSLKVQPSVDS-IQLSWLPP
  CN:CN16484/1-1420              DKEERT------------------------------LGAPREIRPHAGIDY-ILVSWLPP
  JA:JA57681/1-866               DKEERT------------------------------LGAPREIRPHAGIDY-ILVSWLPP
  WP:CE25115/1-1415              DKEERT------------------------------LGAPREIRPHAGIDY-ILVSWLPP
  RP:RP26668/1-1432              DKEERT------------------------------LGAPREIRPHAGIDY-ILVSWLPP
  BP:CBP38503/1-1487             DKEERT------------------------------LGAPREIRPHAGIDY-ILVSWLPP
  FLYBASE:CG8581/1-1526          DLDETQ-----------------------------VPGKPIWISIHPGANN-IALHWGPP
  ENSEMBL:ENSP00000389140/1-1447 DLDESQ-----------------------------VPDQPSSLHVRPQTNC-IIMSWTPP
  SW:P70211/1-1447               DLDESQ-----------------------------VPDQPSSLHVRPQTNC-IIMSWTPP
                                   :                                  . *  :      :  : : * .*
  
  
  WP:CE26976/1-4280              IDPKGYVTQYRVSI-VSLDDVNDKKRTHIVNHPTLTYLFEELNPETSYNISISAGTKQGF
  PP:PP48100/1-3609              LDPQNLITQYRVSI-VSLDDVNDQKRSHLVDHPTLTHLFENLQPETSYNISIAAGTKRGF
  SRP:SRP08301/1-1589            KDDSVIIRGYNIGWGVNVPDVDSVQ----VDENTKEYTIKNLKPNKEYVISARAFNNAGN
  OV:OVP04334/1-1751             RDDSVMIRGYLIGWGINIPDVDQVK----VPASLRLYTINGLRPGRDYVISLRAYNLIGN
  BM:BM45234/1-1465              RDDSVMIRGYLIGWGINIPDVDQVK----VPASLRLHTINGLKPGRDYVISLRAYNMIGN
  CN:CN16484/1-1420              ADEQNIVRGYQIGWGLSVPDTETAR----VTASTTQYKIARLNSERDYVISLRAFNNLGS
  JA:JA57681/1-866               ADEQNLVRGYQIGWGLSVPDTETAR----VSASTTQYKISRLHSERDYVISLRAFNNLGS
  WP:CE25115/1-1415              ADEQNLVRGYQIGWGLSVPDTETIR----VTASTTQYKIARLHSERDYVISLRAFNNLGS
  RP:RP26668/1-1432              ADEQNLVRGYQIGWGLSVPDTETIR----VTASTTQYKISRLNSERDYVISLRAFNNLGS
  BP:CBP38503/1-1487             ADEQNLVRGYQIGWGLSVPDTETIR----VTASTTQYKISRLSSERDYVISLRAFNNLGS
  FLYBASE:CG8581/1-1526          QHPEIKIRNYVLGWGRGIPDENTIE----LKETERYHILKNLESNMDYVVSLRARNVKGD
  ENSEMBL:ENSP00000389140/1-1447 LNPNIVVRGYIIGYGVGSPYAETVR----VDSKQRYYSIERLESSSHYVISLKAFNNAGE
  SW:P70211/1-1447               LNPNIVVRGYIIGYGVGSPYAETVR----VDSKQRYYSIERLESSSHYVISLKAFNNAGE
                                  . .  :  * :.   .    :  .    :      : :  * .   * :*  * .  * 
  
  
  WP:CE26976/1-4280              GREIWTRYTTDPFNIPVVGTMPTV------------TPDGANALDVQWNAVLDPKNRVKG
  PP:PP48100/1-3609              GPEIWTRYSTDLFKVPVVFTAPVV------------TPDGPHSLDVAWSAVSDSNNRIKG
  SRP:SRP08301/1-1589            G-------------FPIYETIRTTSYSNNVFAGFGKSNDKNKGSDETYYNDDDESFGSEG
  OV:OVP04334/1-1751             G-------------FPIYETVRTL------------SPDSKSIAGGQQNGKDS-------
  BM:BM45234/1-1465              G-------------FPIYETVRTL------------SPESKSMASGQQNNKDS-------
  CN:CN16484/1-1420              G-------------FPIYETVRTL------------SRESP-RFNEDYDGEDS--DRSAG
  JA:JA57681/1-866               G-------------FPIYETVRTL------------SRASMSHFSDNDDDGDADMNSDDS
  WP:CE25115/1-1415              G-------------FPIYETVRTL------------SRETPSHFNEDSDSDDS-------
  RP:RP26668/1-1432              G-------------FPIYETVRTL------------SRETP-HFSEDSDSDDS-----DG
  BP:CBP38503/1-1487             G-------------FPIYETVRTL------------SRETP-HFSEDSDSDDA-----DG
  FLYBASE:CG8581/1-1526          G-------------PPIYDNIKTR----------------------DEEPVDA-------
  ENSEMBL:ENSP00000389140/1-1447 G-------------VPLYESATTR------------SITDPTDPVDYYPLLDDFPTSVP-
  SW:P70211/1-1447               G-------------VPLYESATTR------------SITDPTDPVDYYPLLDDFPTS--G
                                 *              *:  .  .                                     
  
  
  WP:CE26976/1-4280              YIIEIRNSDTPVWQEIGGVTNHDAGKSTYFKKLTGLDSDTLYFIRIKVVDQRQRVGVPSP
  PP:PP48100/1-3609              YLIEIRNSETGQWQEIGGMTPHEAGKNRFEKKLTGLDPDTLYFVRIKVVDKSNRTSGPSP
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               P-----------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              EAQARTGCAAPLSPPTNLNLASPSNVQVRVSWQAP-----NQNSWKCSAIRYKLEYINGT
  PP:PP48100/1-3609              EAQGRTGCAAPTAPPANLQLASPNSGQVRATWQAP-----AQGSWRCGLIRYKLEFVDGS
  SRP:SRP08301/1-1589            ----KFEATDENGVPTYVTSETLSATSIKISWSEE-----NINVFN---PEYSVKYFSRA
  OV:OVP04334/1-1751             ---------ERSETPIGVRALTLSSSSIRVTWTDA----EMDIPYS---RQYTVRYSSSI
  BM:BM45234/1-1465              --------GRSE-TPIGVRALTLSSSSIRVIWTDA----ELDIPYS---RQYTVRYSSNV
  CN:CN16484/1-1420              ------GAGSPETTPVGLRSEATSATSIRVIWTEP-----DETAFN---IQYTVRYSTAI
  JA:JA57681/1-866               ------SRGNSDSTPVGLRADAISATSIRVVWTES-----DETAFN---TQYTVRYSTAI
  WP:CE25115/1-1415              ------DVGSSESTPVGVRAEAISATSIRVMWTES-----DETAFN---TQYTVRYSTAV
  RP:RP26668/1-1432              ------ALGSSESTPVGLRTEAVSGTSIRVMWTES-----DESAFN---TQYTVRYSTAV
  BP:CBP38503/1-1487             ------QLGSSESTPVGLRTEAVSGTSIRVMWTES-----DESAFN---TQYTVRYSTSV
  FLYBASE:CG8581/1-1526          --------PTPLEVPVGLRAITMSSSSIVVYWIDTMLNKNQHVTDN---RHYTVSY--GI
  ENSEMBL:ENSP00000389140/1-1447 ------DLSTPMLPPVGVQAVALTHDAVRVSWADNSVPKNQKTSEV---RLYTVRWRTSF
  SW:P70211/1-1447               ------DVSTPMLPPVGVQAVALTHEAVRVSWADNSVPKNQKTSDV---RLYTVRWRTSF
                                               *  :   : .   :   *                   *.: :    
  
  
  WP:CE26976/1-4280              EG-RKQIDLPSSSIEHLFDS-KSNTKWTVRIRTENDAGSSE-WSKELSITTSEGAP-GPV
  PP:PP48100/1-3609              NP-RATLDLPSSAIEKTFDS-KPNTKWTVRIRTENDAGQSP-WSNELTLTTAEGAP-GPV
  SRP:SRP08301/1-1589            DPRGEVKYVKTSENEIEIEGLRPNTVYEFSIRLIGSTK----WSAPSSNKTMPAPPSSAP
  OV:OVP04334/1-1751             ENGGQRRYINTSEMEVVIEGLRPNTQYEFAVRVNAGKSSSM-WSMTAVNSTAPAPPSSAP
  BM:BM45234/1-1465              ENGGQRRYINTSELEVVIDGLRPNTQYEFAVRVNAGKSSSM-WSMTAVNSTAPAPPSSAP
  CN:CN16484/1-1420              DG-NQHRYINSTETWATVEGLRPATEYEFAVRAVTSNGQLSTWSMATRNRTLTAPPSSAP
  JA:JA57681/1-866               DG-NQHRYVNSTETWATIEGLRPATEYEFAVRAVASNGQLSTWSMATRNRTSSAPPSSAP
  WP:CE25115/1-1415              DG-NQHRYVNSTETWATVEGLRPATEYEFAVRAVASNGQLSTWSMATRNRTLAAPPSSAP
  RP:RP26668/1-1432              DG-NQHRYVNSTETWATVEGLRPATEYEFAVRAVASNGQLSTWSMATRNRTWSAPPSSAP
  BP:CBP38503/1-1487             DG-NQHRYVNSTETWATVEGLRPATEYEFAVRAVASNGQLSTWSMAARNRTWSAPPSSAP
  FLYBASE:CG8581/1-1526          TGSNRYRYHNTTDLNCMINDLRPNTQYEFAVKVVKGRRESS-WSMSVLNSTYQNVPVTPP
  ENSEMBL:ENSP00000389140/1-1447 SASAKYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRSST-WSMTAHATTYEAAPTSAP
  SW:P70211/1-1447               SASAKYKSEDTTSLSYTATGLKPNTMYEFSVMVTKNRRSST-WSMTAHATTYEAAPTSAP
                                           ::       . :. * : . :    .      **      *    *  . 
  
  
  WP:CE26976/1-4280              EGLTAKP-------TGPTSIVARWKPPRDPNGVITGYTLTYQLKSIGECGPRSSTPIEKH
  PP:PP48100/1-3609              TGLKAQP-------DGPNTATVTWNPPAEPNGEISGYTVVYNLKSLGECGPRSAQPLQKH
  SRP:SRP08301/1-1589            QDLTIIPPSQHYRKSDPNSVTLNWQPPKYANGEILEYLIYYSNKEE--------------
  OV:OVP04334/1-1751             RDLTIMQPID----GDPQTLILNWQPPKYANGDIEEYLVYYADRSD--------------
  BM:BM45234/1-1465              RDLTIMQPTD----GDPQTLILNWQPPKYANGDIEEYLVYYADRSD--------------
  CN:CN16484/1-1420              RDLTVLPAES----GDPHSASLHWQPPKYSNGEIEEYLIFYTESPT--------------
  JA:JA57681/1-866               RDLTVLPAES----GDPHSASLHWQPPKYANGEIEEYLIFYTDRAS--------------
  WP:CE25115/1-1415              RDLTVLPAES----GDPHSSSLHWQPPKYSNGEIEEYLVFYTDRAS--------------
  RP:RP26668/1-1432              RDLTVLPAES----GDPHSASLHWQPPKYSNGEIEEYLVFYTDRES--------------
  BP:CBP38503/1-1487             RDLTVLPAES----GDPHSASLHWQPPKYSNGEIEEYLVFYTDRES--------------
  FLYBASE:CG8581/1-1526          REVTVRLDE-----MNPPTVIVQWIPPKHTLGQITGYNIYYTTDTT--------------
  ENSEMBL:ENSP00000389140/1-1447 KDLTVITRE-----GKPRAVIVSWQPPLEANGKITAYILFYTLDKN--------------
  SW:P70211/1-1447               KDLTVITRE-----GKPRAVIVSWQPPLEANGKITAYILFYTLDKN--------------
                                   :.            * :    * **  . * *  * : *                   
  
  
  WP:CE26976/1-4280              VKNEEETLEGLLPDSTYEIHVVAHTSHAGPQSSVVTVTTEEAAPTGPPQNVRAGSVTSSR
  PP:PP48100/1-3609              AKTPEVSLDGLLPDATYEVHVIAHTSLAGPRSEIITFTTEESAPTGAPLHVKVGSVTANR
  SRP:SRP08301/1-1589            -----------LPDKD--------------------------------------------
  OV:OVP04334/1-1751             -----------APDKD--------------------------------------------
  BM:BM45234/1-1465              -----------APDKD--------------------------------------------
  CN:CN16484/1-1420              -----------LSDKE--------------------------------------------
  JA:JA57681/1-866               -----------LADKD--------------------------------------------
  WP:CE25115/1-1415              -----------LADKD--------------------------------------------
  RP:RP26668/1-1432              -----------LADKD--------------------------------------------
  BP:CBP38503/1-1487             -----------LSDKD--------------------------------------------
  FLYBASE:CG8581/1-1526          -----------KRDRD--------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 -----------IPIDD--------------------------------------------
  SW:P70211/1-1447               -----------IPIDD--------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              ADITWTQPECEQRNGKITDYEYELWSMDTWADNSTGHNPTERLNLDQLIPYTQYQIRVRA
  PP:PP48100/1-3609              ADVTWQQPECEKRNGKITAYEYELETQDEWGENKTDTSRSERVTFDALVPFTRYRIRVKA
  SRP:SRP08301/1-1589            ------------------------WLRDSVRGDKLSLE------ISNLLPFTTYHFKVQA
  OV:OVP04334/1-1751             ------------------------WILDGVKGDHLSIK------LTNLLPRQTYFFKVQA
  BM:BM45234/1-1465              ------------------------WILDGVKGDHLSIK------LTNLLPRQTYFFKVQA
  CN:CN16484/1-1420              ------------------------WIINYVAGDKLSHQ------VSNLLPKANYFFKIQA
  JA:JA57681/1-866               ------------------------WTINYVGGEKLSHQ------VSNLLPKANYFFKIQA
  WP:CE25115/1-1415              ------------------------WTINYVAGDKLSHQ------VSNLLPKANYFFKIQA
  RP:RP26668/1-1432              ------------------------WTINYVAGDKLSHQ------VSNLLPKANYFFKIQA
  BP:CBP38503/1-1487             ------------------------WTINYVAGDKLSHQ------VSNLLPKANYFFKIQA
  FLYBASE:CG8581/1-1526          ------------------------WSVEAFAGEETMLM------LPNLKPYTTYYFKVQA
  ENSEMBL:ENSP00000389140/1-1447 ------------------------WIMETISGDRLTHQ------IMDLNLDTMYYFRIQA
  SW:P70211/1-1447               ------------------------WIMETISGDRLTHQ------IMDLSLDTMYYFRIQA
                                                            :    :           .  *     * ::::*
  
  
  WP:CE26976/1-4280              INK----------------EGDG--PFSEWVPFTTSATNPPAPSDLQEEATFPHAIEISW
  PP:PP48100/1-3609              QNK----------------EGDG--PFSDWVAFTTASSAPGLPTDLKEEGTFPHAIEVSW
  SRP:SRP08301/1-1589            RNV----------------KGYG--PLSRPVSY---------------------------
  OV:OVP04334/1-1751             RNI----------------KGYG--PLSPILQF---------------------------
  BM:BM45234/1-1465              RNI----------------KGYG--PLSPTLQF---------------------------
  CN:CN16484/1-1420              RNEKGKLSNRCFHIISSYFKGHG--PFSLNVGY---------------------------
  JA:JA57681/1-866               RNE----------------KGHG--PFSSVVGY---------------------------
  WP:CE25115/1-1415              RNE----------------KGHG--PFSSVVGY---------------------------
  RP:RP26668/1-1432              RNE----------------KGHG--PFSSIVGY---------------------------
  BP:CBP38503/1-1487             RNE----------------KGHG--PFSSIVGY---------------------------
  FLYBASE:CG8581/1-1526          RTT----------------KGANNAPFSALVSY---------------------------
  ENSEMBL:ENSP00000389140/1-1447 RNS----------------KGVG--PLSDPILFRTLKVE---------------------
  SW:P70211/1-1447               RNV----------------KGVG--PLSDPILFRTLKVE---------------------
                                  .                 :* .  *:*  : :                           
  
  
  WP:CE26976/1-4280              LPPTPPHGNIDFYKVRYTPSGEANYREIRVETDRLECSDSNKKDRLCYRLSDLDPEQEYD
  PP:PP48100/1-3609              LAPTPPHGVIDFYRIRHTKSEQLNYKEVRVETDRLLCSEARNRDRLCYRISDLDPEETYT
  SRP:SRP08301/1-1589            --------MISGSQSKNLG-----------------------------------------
  OV:OVP04334/1-1751             ---VPGAPPPPLFQSTDID-----------------------------------------
  BM:BM45234/1-1465              ---VPGAPPPRLFQDVDID-----------------------------------------
  CN:CN16484/1-1420              ---TPNGGAILSGRDRSSS-----------------------------------------
  JA:JA57681/1-866               ---TPSGGAILSGRERT-------------------------------------------
  WP:CE25115/1-1415              ---TPSGGAILSGKDRHNA-----------------------------------------
  RP:RP26668/1-1432              ---TPSGGAILSGRDRNSP-----------------------------------------
  BP:CBP38503/1-1487             ---TPSGGAILSGRDRNVP-----------------------------------------
  FLYBASE:CG8581/1-1526          ---TTSAAVTMQEP----------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ---HPDKMANDQGRHGD-------------------------------------------
  SW:P70211/1-1447               ---HPDKMANDQGRHG--------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              IQVSAHTEGGGWSEWSDELTSRTQQQNIPVLERELEVTDKTSNSISLKWEGLPQDQATHV
  PP:PP48100/1-3609              IQVAAHTEGGAWSDWSEPLDARTQQQNIPVLERELTIIETKPNSITVGWEGLPADLAQHV
  SRP:SRP08301/1-1589            -------------IFGNEEGSLLSPKIIS--------------FIRANFILIIIGVIVIV
  OV:OVP04334/1-1751             ---------------------LETPHLVL--------------FSTPAYLVFMVAIFILL
  BM:BM45234/1-1465              ---------------------LETPRLAL--------------FSTPAYLAITAAIVILF
  CN:CN16484/1-1420              -------QNHGSTSRGGAVSFVDQLQSLL--------------QSNPLLLMLTAALLLIL
  JA:JA57681/1-866               -------RGHGS-TSSDQTSLVEQFKSIL--------------QSNPLYLMLLVAFALIL
  WP:CE25115/1-1415              -------RGHGSAASGDTVSLVDQLQSLL--------------HSNPLYLILLAAFALIL
  RP:RP26668/1-1432              -------RGHGSAAAGDSISLVEQLQSIF--------------SSNPLYLMLLIAFALIL
  BP:CBP38503/1-1487             -------RGHGS-AMGDTVSLIEQLQSIF--------------QTNPLYLMLLIAFALIL
  FLYBASE:CG8581/1-1526          ----------------DTIAKGIDNEKLL-------------------YIIIAATAVVLL
  ENSEMBL:ENSP00000389140/1-1447 --------GGYWPVDTNLIDRSTLNEPPIGQMHPPHGSVTPQKNSNLLVIIVVTVGVITV
  SW:P70211/1-1447               -------DGGYWPVDTNLIDRSTLNEPPIGQMHPPHGSVTPQKNSNLLVITVVTVGVLTV
                                                          .                         .       .
  
  
  WP:CE26976/1-4280              VGYVLEFKSEDDNAEWQEY-NGVVKHRKTSSDYKITVKQLETATLYFFRLRVVGKNDKRG
  PP:PP48100/1-3609              VGYVLEYK-DADAENWQEVESGIVRHRATNNNYKVPVRGLDTATEYFFRLRVVGKNDKRG
  SRP:SRP08301/1-1589            VLLLIIIL------------CAIICSNRRNNP-KSSMAHQNGALYSTVNNRRQGINDKDN
  OV:OVP04334/1-1751             IILLIAV---------------IWYIRSKNIK-KSTASGYMRGKKQF--------KNGKG
  BM:BM45234/1-1465              MVLMITV---------------IWYIRSKNSK-KSTTAGYVRGRKQV--------RNGKG
  CN:CN16484/1-1420              ILIVILI---------------VMCCVKRNNA-GGRKNGYQSAKKTS----NGGGVGGAG
  JA:JA57681/1-866               VLTLILI---------------IMCCVKRSGGSGGRKNGYQSGKKTS----VGGAMGGAG
  WP:CE25115/1-1415              ILTLILI---------------IMCCWKRSSG-GGRKNGYQSGKKTSAGAGSGGGIGGLG
  RP:RP26668/1-1432              ILTLILI---------------IMCCLKRSNG-GGRKNGYQSAKKTS----ANGGVGGIG
  BP:CBP38503/1-1487             ILTLILI---------------IMCCLKRSGG-GGRKNGYQSAKKTS---GSGGVGGGIG
  FLYBASE:CG8581/1-1526          VVLLGVL---------------LLCRRKPQSSPEHTKKSYQ--------------KNNVG
  ENSEMBL:ENSP00000389140/1-1447 LVVVIVA---------------VICTRRSSAQQRKKRATHSAGKR----------KGSQK
  SW:P70211/1-1447               LVVVIVA---------------VICTRRSSAQQRKKRATHSVSKR----------KGSQK
                                 :  :                  :      .                          .   
  
  
  WP:CE26976/1-4280              Q-PGPETKETTSCGKPEAPPESLKLESLDFETLKITWTPPEESTWRCDNVEYLIDFVN-T
  PP:PP48100/1-3609              Q-PGPELRAMTNCGKPEEPPANIKMESIDFEKVRISWDPPAEETWQCDDVEFVIEYVN-T
  SRP:SRP08301/1-1589            RDG-V------------------------------------SDLW-----------INGN
  OV:OVP04334/1-1751             --P-P-------------------------------------DLW-----------INHH
  BM:BM45234/1-1465              --P-P-------------------------------------DLW-----------INHH
  CN:CN16484/1-1420              G-P-P------------------------------------NDLW-----------IN-G
  JA:JA57681/1-866               GGP-P------------------------------------NDLW-----------IN-G
  WP:CE25115/1-1415              G-P-P------------------------------------NDLW-----------IN-G
  RP:RP26668/1-1432              G-P-P------------------------------------NDLW-----------IN-G
  BP:CBP38503/1-1487             G-P-P------------------------------------NDLW-----------IN-G
  FLYBASE:CG8581/1-1526          V-PKP------------------------------------PDLW-----------IH-H
  ENSEMBL:ENSP00000389140/1-1447 D-LRP------------------------------------PDLW-----------IH-H
  SW:P70211/1-1447               D-LRP------------------------------------PDLW-----------IH-H
                                                                           . *           ::  
  
  
  WP:CE26976/1-4280              TSRGNWTVSTDAPSELIVPTQPGTKWDVKIRTQTVEDSGKPQASRWSDRVSITTQSLPGE
  PP:PP48100/1-3609              TGRGSLVVPTDANNEMVIDTLPGTKWDIKMRTQTVEEGEKPQQSRWSDRVTLTTMSLPGE
  SRP:SRP08301/1-1589            PNNSSREVYCDTPEITLLDGQRMAKNS----------ADSPPP-----------------
  OV:OVP04334/1-1751             SGGHQIH----EPENLIEEALAVPSNDLNHCGDVIQMVDSPQS-----------------
  BM:BM45234/1-1465              SGGHQIH----EPENLIEEALATSLNDLNHCDDVIEMVDSPRS-----------------
  CN:CN16484/1-1420              VGSHMRA----GASDYMVDGLATAHL-------TAAEMESPTP-----------------
  JA:JA57681/1-866               TGSHMRA----GASDYMVDGLATAHL-------TAADIESPTP-----------------
  WP:CE25115/1-1415              TGSHMRA----GASDYMVDGLATAHL-------TAADIESPTP-----------------
  RP:RP26668/1-1432              TGSHMRA----GASDYMVDGLATAHL-------TAADIESPTP-----------------
  BP:CBP38503/1-1487             TGSHMRA----GASDYMVDGLATAHL-------TAADIDSPTP-----------------
  FLYBASE:CG8581/1-1526          DQMELKN---------IDKGLHT-----------------VTP-----------------
  ENSEMBL:ENSP00000389140/1-1447 EEMEMKN----------IEKPSGT---------DPAGRDSPIQ-----------------
  SW:P70211/1-1447               EEMEMKN----------IEKPTGT---------DPAGRDSPIQ-----------------
                                                                                             
  
  
  WP:CE26976/1-4280              IFVTVEPKGPREALVTWELPDKDQKWNYGVDITYKLKQLGGCNEVQTGAKEPVTLLNVQE
  PP:PP48100/1-3609              LFVKVEPKGTKEALVIWDLIDKSRKWDYGVDISYRLKSLGGCSEQLTGAQEPINVLNVQE
  SRP:SRP08301/1-1589            LYQTLQDNQKGLNSLSPFSLCPSVDARRISTSSDISVSTNICKGRTPPMLPLRMTESLHE
  OV:OVP04334/1-1751             QYLTL-----------------------------------QAQFTDPEYVESRMTQSVHD
  BM:BM45234/1-1465              QYLAV-----------------------------------QAHFTDPEYIEARMTQSVHD
  CN:CN16484/1-1420              RYHHL-------------------------------------------------------
  JA:JA57681/1-866               RYHHL-------------------------------------------------------
  WP:CE25115/1-1415              RYHHL-------------------------------------------------------
  RP:RP26668/1-1432              RYHHL-------------------------------------------------------
  BP:CBP38503/1-1487             RYHHL--------------------------QDSVYGSIHGASGNPTTRPPRAPKRGNSG
  FLYBASE:CG8581/1-1526          VCSDG-------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 SCQDL-----------------------------------TPVSHSQSETQLGSKSTSHS
  SW:P70211/1-1447               SCQDL-----------------------------------TPVSHSQSETQMGSKSASHS
                                                                                             
  
  
  WP:CE26976/1-4280              KQIPLENLQPGSLYEVSVTPRRPPSLHSSIVTPKTVRTFRTKNDVPTGPPQNLQSTVRKD
  PP:PP48100/1-3609              KEHMLTDLKPGSTYEITVTPRRPPSLPSSIVSPKTVRTFTTGADIPTGAPQNVQSTVRKD
  SRP:SRP08301/1-1589            PKKVLVPTVPYLRPIVVPSLATIKSLKLASFAFKKEISETNSGDTPSTTATFLSNSENG-
  OV:OVP04334/1-1751             G----------------IIQRRRPVGKAELISTHAVISQNPLPATVIGD-----------
  BM:BM45234/1-1465              G----------------IIQRRRPVGKAELISTHTVMSQNPLPGVVTGD-----------
  CN:CN16484/1-1420              --------------------------------------------------Q---------
  JA:JA57681/1-866               --------------------------------------------------Q---------
  WP:CE25115/1-1415              --------------------------------------------------Q---------
  RP:RP26668/1-1432              --------------------------------------------------Q---------
  BP:CBP38503/1-1487             SRSTPMAQSMCSAIGTTEDEDEEPVESLVATRVRIERPVQRAKAIVTGTVQ---------
  FLYBASE:CG8581/1-1526          -----------------------ASSSGALTLPRSVVHSEYEVETPVPGHV---------
  ENSEMBL:ENSP00000389140/1-1447 GQDTEEAGSSMSTLERSLAARRAPRAKLMIPMDAQSNNPAVVSAIPVPTLESAQ------
  SW:P70211/1-1447               GQDTEDAGSSMSTLERSLAARRATRAKLMIPMEAQSSNPAVVSAIPVPTLESAQ------
                                                                                             
  
  
  WP:CE26976/1-4280              SELGFKWDAPECIQQNGNITQYEFELVGLDEWNEGTREGVTPRQNTLIDQLQPGSLYRIK
  PP:PP48100/1-3609              TELGFKWEAPECAAKNGNITQYEFELAGLDEWNEGIKEGVTPRLNTLINELQPGSLYSLK
  SRP:SRP08301/1-1589            --------------DCGTLQRSYHHSSNSLEIGSQRQR--TPQI----------------
  OV:OVP04334/1-1751             --------------CNGTLSRSYHQSSTSLE---GRQR--TPQI----------------
  BM:BM45234/1-1465              --------------CNGTLTRSYHQSSTSLE---GRQR--TPQI----------------
  CN:CN16484/1-1420              --------------GPGTLTRSYHQSSQSLE---GRQR--TPQV----------------
  JA:JA57681/1-866               --------------GQGTLTRSYHQSSQSLE---GRQR--TPQV----------------
  WP:CE25115/1-1415              --------------GQGTLTRSYHQSSQSLE---GRQR--TPQV----------------
  RP:RP26668/1-1432              --------------GQGTLTRSYHQSSQSLE---GRQR--TPQV----------------
  BP:CBP38503/1-1487             --------------GQGTLTRSYHQSSQSLE---GRQR--TPQV----------------
  FLYBASE:CG8581/1-1526          --------------TNSLDKRSYVPGYMTTSMNGTMERPQYPRT----------------
  ENSEMBL:ENSP00000389140/1-1447 --------------YPGILPSPTC----------GYPH---PQF----------------
  SW:P70211/1-1447               --------------YPGILPSPTC----------GYPH---PQF----------------
                                                 .                    .   *:                 
  
  
  WP:CE26976/1-4280              VRAYTAEGPGPWSDSLEIRTTGSELGPPRELTAVQTKATQIQLTWLPPYPEKAIVTAYRI
  PP:PP48100/1-3609              VRAYTAEGPGPWSDPLEIRTTGSELGPPRELTAVQTKSTQIQLTWLPPYPEKAIVTAYKL
  SRP:SRP08301/1-1589            --LYTGTNR-QPIAKIDFTSTTASDVGSNFSGSTTALPVHTP---PP-------------
  OV:OVP04334/1-1751             --VYTNTGRHQ-VAKIDFSDHSSTYSSSQALHISTPPPPQLPNQGPPVAP----------
  BM:BM45234/1-1465              --VYTNTGRHQ-VAKIDFSDHSSTYSSSQALHISTPPPPQLPNQGPPVAP----------
  CN:CN16484/1-1420              --VYTGTGRHQPIHKIDF---ESPYGSSSAIGSASTPPL-PPVQAPPSGP----------
  JA:JA57681/1-866               --VYTGTGRHQPIHKIDF---DSPYGSSSAIGSASTPPL-PPMQAPPSVP----------
  WP:CE25115/1-1415              --VYTGTGRHQPIQRIDF---ESPYGSSSAIGSASTPPL--PMQAPPSGP----------
  RP:RP26668/1-1432              --VYTGTGRHQPIHKIDF--DNSLYGSSSAIGSASTPPL-PPMQAPPSGP----------
  BP:CBP38503/1-1487             --VYTGTGRHQPIHKIDF---DSPYGSSSAIGSASTPPL-PPMQAPPSGP----------
  FLYBASE:CG8581/1-1526          --QYSHQNRSH---------------MTMEAGLSQQSLTQPQSNSMAQTP----------
  ENSEMBL:ENSP00000389140/1-1447 ------TLRPVPFPTLSV---DRGFGAGRSQSVSEGPTTQQPPMLPPSQPEH--------
  SW:P70211/1-1447               ------TLRPVPFPTLSV---DRGFGAGRTQSVSEGPTTQQQPMLPPAQPEH--------
                                                                               .             
  
  
  WP:CE26976/1-4280              RYSPRADDSNPTEVELSGDDLTCSG-YKSPIITSANLCATIKGLQPSTTYRFAVQGQSSS
  PP:PP48100/1-3609              RYSPRADDSNPTEIEISGDDLTCSG-YKSPMLTSDNLCTTVKGLAPATTYRFAVQGRAAS
  SRP:SRP08301/1-1589            -----------------------QG-DISYSGSNVSK-RPSSHLRSFTHLNN--IGLSYV
  OV:OVP04334/1-1751             ----------PAQL------VCTDG-YKTLRRNSVNS----NPLKSFTQLAGAPPPITPT
  BM:BM45234/1-1465              ----------PTQL------LNNDG-YRTLRRNSVNS----NPLKSFTQLAGAPPPITPS
  CN:CN16484/1-1420              ----------PTVI---------DG-YRTLRGTPVNS-SAANALRSFTQLAGA-TPPPPH
  JA:JA57681/1-866               ----------PTVI---------DG-YRTLRGTPPNS-SGANALRSFTQLAGTVTPTPPL
  WP:CE25115/1-1415              ----------PTVI---------DG-YRTLRGTPPNS-SAANALRSFTQLAGATPPPPHS
  RP:RP26668/1-1432              ----------PTVI---------DG-YRTLRGTPPNS---ANALRSFTQLSGATPPPPHS
  BP:CBP38503/1-1487             ----------PTVI---------DG-YRTLRGTPPNS-SAANALRSFTQLAGATPPPPHS
  FLYBASE:CG8581/1-1526          ----------EHPYGGYDANFCNAG-NAAAGNGCVST--IESSKRGHPLKSFSVPGPPPT
  ENSEMBL:ENSP00000389140/1-1447 ----------SSSE---------EAPSRTIPTACVRP---THPLRSF---ANPLLPPPMS
  SW:P70211/1-1447               ----------PSSE---------EAPSRTIPTACVRP---THPLRSF---ANPLLPPPMS
                                                         .   :                            .  
  
  
  WP:CE26976/1-4280              GNWGEWSSDYFSTTRNDDNELLGGSLKLLSAG----------H--DNLKVKWTPPAVIGE
  PP:PP48100/1-3609              GNWGEWSSDYFSTTRKDDNDLLGGSLKLLSAG----------S--DNLKVKWTPPAVIGD
  SRP:SRP08301/1-1589            NNQQAKTAHIVRPLPTSNSPIATSTPTAPSNGSPGIIKPYNSHSQTSVPIGRASAQPRVN
  OV:OVP04334/1-1751             SGSGERMAHVVRPLVIASPNTRNGKPAGVVIG----------QKSSHVPVGRAAAQPRVN
  BM:BM45234/1-1465              SGSGERMAHVVRPLVVASPNNRNGKPAGVVIG----------QKSSHVPVGRATAQPRVN
  CN:CN16484/1-1420              SA-----------------PSSSSRPTIIAAG----------G--RQVPVGRATAQPRVN
  JA:JA57681/1-866               SG----------------PPSAN-RPTIIAAG----------G--RQVPVGRATAQPRVN
  WP:CE25115/1-1415              AA-----------------SSSS-RPTIIAAG----------G--RQVPVGRATAQPRVN
  RP:RP26668/1-1432              A------------------PSSSSRPTIIAAG----------G--RQVPVGRAAAQPRVN
  BP:CBP38503/1-1487             AT-----------------STSSMRPTIIAAG----------G--RQVPVGRATAQPRVN
  FLYBASE:CG8581/1-1526          GG--------------------------------------------ATPVTKHTPAVTIR
  ENSEMBL:ENSP00000389140/1-1447 AI----------------EPKVPYTPLLSQPG-------------PTLPKTHVKTASLGL
  SW:P70211/1-1447               AI----------------EPKVPYTPLLSQPG-------------PTLPKTHVKTASLGL
                                                                                       .     
  
  
  WP:CE26976/1-4280              KIDK---YDIFISVASVLDQNPKKFDVNGQTTDYHFRHLDSVTQYNVTVQGTSEGNKLWF
  PP:PP48100/1-3609              KIDS---YQLFISVASQLDEHPNEHGTPGAQTDYHFRGLQPVTQYNVTVEGTAAGSKLWF
  SRP:SRP08301/1-1589            MASI---YTPVS---------PIKNNQNNVIGINDNETDSRYSDSTMGFNQDTNYNHLNN
  OV:OVP04334/1-1751             VNNI---YAPYASCPV-----P------EKATLQLENVIESQPLQA--------------
  BM:BM45234/1-1465              VNNI---YSPYASCVM-----P------EKAALQRENVIEAQPLQA--------------
  CN:CN16484/1-1420              VANI---YSPYPS---------SEAGESDKKG-ECMEMKESTPIKT-------NEKMNAN
  JA:JA57681/1-866               VANI---YSPFASCSA-----PSEAG-SDKKG-ECMEMRESTPIKT--------------
  WP:CE25115/1-1415              VANI---YSPFASCSA-----SSDAGESDKKSGECMEMRETTPIKSNTAGSSNGEKMNTN
  RP:RP26668/1-1432              VANI---YSQLASCSA-----SSDAGESDKTGVECMEMRETTPIKTI----PPGDKTANN
  BP:CBP38503/1-1487             VANI---YSPFASCSA-----SSDAGDSDKKG-ECMEMRETTPVKT-----TGSDKIVAN
  FLYBASE:CG8581/1-1526          PQNQSPYKKPSFSAAT-----PNRLQGGGSVVHSTDEIQRLAP-----------------
  ENSEMBL:ENSP00000389140/1-1447 AGKA---RSPLLPVSV-----PTAPEVSEE---SHKPTEDSANVYE--------------
  SW:P70211/1-1447               AGKA---RSPLLPVSV-----PTAPEVSEE---SHKPTEDPASVYE--------------
                                   .                                                         
  
  
  WP:CE26976/1-4280              ISSVFSTTDFAEGLLNWLPAPTDLHLIEKS-DTMLHVDWVPPEIFDPEQRELITHHRVTI
  PP:PP48100/1-3609              ISNVFSTTDHAEGLLDWLTAPTDLRLIEKS-ETMLHVDWVPPEIFDEEKRELLTHYRVTI
  SRP:SRP08301/1-1589            LQPSNSFEEINSEMESLNTMILDIRALHHE------------------------------
  OV:OVP04334/1-1751             ---SASTEELNAQMENLDTMIDDLQALQHDILFTHPIHVESWQCYGLLKQCTIVTRAFSD
  BM:BM45234/1-1465              ---SASTEELNAQMENLDTMIDDLQALQHE------------------------------
  CN:CN16484/1-1420              MMPSHSAEDLNAHLENLDTMLDDLQQLQHN------------------------------
  JA:JA57681/1-866               -----------THQADMLKVGEKKRKLRKN------------------------------
  WP:CE25115/1-1415              MNPSHSAEDLNAHLENLDTMLDDLQQLQHN------------------------------
  RP:RP26668/1-1432              MLPSHSTEDLNAHLENLDTMLDDLQKLQSN------------------------------
  BP:CBP38503/1-1487             MLPSHSTEDLNAHLESLDTMLDDLQQLQHN------------------------------
  FLYBASE:CG8581/1-1526          ---STSTEELNQEMANLEGLMKDLSAITAN------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------QDDLSEQMASLEGLMKQLNAITGS------------------------------
  SW:P70211/1-1447               ------QDDLSEQMASLEGLMKQLNAITGS------------------------------
                                                .      .   :  .                              
  
  
  WP:CE26976/1-4280              APFDPTTGKTGPSKNYTVPYPGNSIKFEGLRPETIYNITVQAGTNSGYGHILWGTYSTLA
  PP:PP48100/1-3609              APYNHNTGKTGPQKNYTVPVPGNSIKFEGLTPATIYNITVQGGTSSGYGHVLWGVYSTLA
  SRP:SRP08301/1-1589            ----------------------------------------------------FNESI---
  OV:OVP04334/1-1751             IKLINPDNMNHFCGNYTYSIIPCLAYSVNYTDFFITKIFIEFQESVYTGTFFLTTFFQMK
  BM:BM45234/1-1465              --------------------------------------------------FSATT-----
  CN:CN16484/1-1420              --------------------------------------------------LHFDT----S
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              --------------------------------------------------LHFETSMDK-
  RP:RP26668/1-1432              ----------------------------------------------------FNK-----
  BP:CBP38503/1-1487             --------------------------------------------------LHLDTSTDK-
  FLYBASE:CG8581/1-1526          ---------------------------------------------------EFEC-----
  ENSEMBL:ENSP00000389140/1-1447 ---------------------------------------------------AF-------
  SW:P70211/1-1447               ---------------------------------------------------AF-------
                                                                                             
  
  
  WP:CE26976/1-4280              PGQRHILRLLNRTPTTLNVAWEPVWGRSHSGYTLTARTLYSVYGNVRLQQIKTFDVDASE
  PP:PP48100/1-3609              PGERHILKLKYRTPTSLHVEWDPVWGSSHRGYILEATQLHSVFKDSKNGVKKQFEVEAKA
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             QQPGNTPHERFLTFRKCIQNDQLKHNKSENTMNMIKILRLYLYGCIYNSMTDMLQDSCFN
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              TEK---------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              TEFVIRGLHPSTVYNVTLTPKDHNEVAWGAYATLPPGWFVVKNLKQCDKTDFAVSMSWEP
  PP:PP48100/1-3609              TDFIINGLHPSTMYNVTLRPRDQQEGAWGAYATLPPGWFTVKNLKQCDKTNFAVSLSWEP
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             KLVQNCVEKTPTVQKCYYWQCKSHDFLTLRKSSIDLAIEDEENEDDENINKTSKEKQKLS
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              VELDMASDYQVRYLRLKEHDGIWTEEEARPAKELLCPKDGCGRLCYLVFNLPHNPTEYVF
  PP:PP48100/1-3609              VDQNQGTHYQY----------------------LLCPKDGCGRHCYLVFNLPAAPGEYVF
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             VKLKVGKLRNFPILRKQTPLSSKMETIEQ-------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              QVRAKVDGEWNHWKSAPKKMTSSEPLSIRRSCCIVPPPYFVDNIGAPGTFWEVDVNPAAT
  PP:PP48100/1-3609              QVRAMVNGQWNMWKSSAKQVV-SEPTEIRKSCCIVPPPYFVENIGATGTHWEIDVNPAHT
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              ENNVTRYYVVVDERDPPGDTNWTELTDKVTANKMKIPYYVAASFNLETLPEPRKVRIGDG
  PP:PP48100/1-3609              DTN---------------------------------------------------------
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              SVIGGYLNYPLVKGKKYNYEVYTIWNVTGAPLVGRLRDSNSWGWLFNRILLQWILLPLAA
  PP:PP48100/1-3609              ------------------------------------------------------------
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              ILLLICLIWCISKFCKDRYRSSKEHSRLVTNGQHAPLLEEQKAGMNENMRQLETRLDKMR
  PP:PP48100/1-3609              ------------------------------------------------------------
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              GAVDGRARGDFEDGYMKGYKDANKLGSAHAARRRLDDDYGTRDDRFHEGYVKGLKDAGMT
  PP:PP48100/1-3609              ------------------------------------------------------------
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              GMTTSMHNLAQRTGGGYSAGFAQGYKDGNSGIFGDRVTPSLISRLDEQYAGQEDFKQGYV
  PP:PP48100/1-3609              ------------------------------------------------------------
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              DGFKEGASSRVGERSRFEDSRKLQQSLTELTERLTSLEKTKGDEIHSTKIYHVYNQQPEG
  PP:PP48100/1-3609              --------------------------------------------IHVTREYD--------
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              ATMSSTGAQLAQELEEIGSTSRRSTLRRHYTPGDYLKQDAEEGYNSLSRNRRSLSASALA
  PP:PP48100/1-3609              ------------------------------------------------------------
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------
                                                                                             
  
  
  WP:CE26976/1-4280              ANREDKSGKWAEQLIDLVSEPLDTTIARINNYTSSSNDRGQGDVVEEKYHRSYKEEHSSR
  PP:PP48100/1-3609              ------------------------------------------------------------
  SRP:SRP08301/1-1589            ------------------------------------------------------------
  OV:OVP04334/1-1751             ------------------------------------------------------------
  BM:BM45234/1-1465              ------------------------------------------------------------
  CN:CN16484/1-1420              ------------------------------------------------------------
  JA:JA57681/1-866               ------------------------------------------------------------
  WP:CE25115/1-1415              ------------------------------------------------------------
  RP:RP26668/1-1432              ------------------------------------------------------------
  BP:CBP38503/1-1487             ------------------------------------------------------------
  FLYBASE:CG8581/1-1526          ------------------------------------------------------------
  ENSEMBL:ENSP00000389140/1-1447 ------------------------------------------------------------
  SW:P70211/1-1447               ------------------------------------------------------------