Welcome to WormBase - need help?

Legend

default*XZ
unknown.
hydrophobicAGLMPV
large hydrophobicFHWY
small alcoholST
cysteineC
negativeDE
polarNQ
positive chargeKR

Protein Alignments

This is the Wormbase protein aligner. To use it, enter a WormBase protein ID.


(e.g. WP:CE25115 or BP:CBP00571)

RP:RP34620(Caenorhabditis remanei)CRE31538
FLYBASE:CG10211(Drosophila melanogaster)Flybase gene name is CG10211-PB
JA:JA48044(Caenorhabditis japonica)CJA00715
CN:CN38022(Caenorhabditis brenneri)CBN08590
WP:CE43668(Caenorhabditis elegans)C46A5.4
OV:OVP00967(Onchocerca volvulus)OVOC4087
SRP:SRP05421(Strongyloides ratti)SRAE_X000005100
BM:BM40734(Brugia malayi)Bm8113
PP:PP23975(Pristionchus pacificus)PPA28156
SW:Q3UQ28(Mus musculus)Peroxidasin homolog
ENSEMBL:ENSP00000252804(Homo sapiens)Isoform 1 of Peroxidasin homolog
MUSCLE (v3.8.31) multiple sequence alignment
  
  
  SW:Q3UQ28/1-1475               ---MAVRPTRRCLLALLLCFAWWAMAV---------------------------------
  ENSEMBL:ENSP00000252804/1-1479 MAKRSRGPGRRCLLALVLFCAWGTLAV---------------------------------
  FLYBASE:CG10211/1-1394         ---------MRKPEMLISLILWCLCASSLT------------------------------
  RP:RP34620/1-1237              ------------MFFLLLFISSSLVSEGWS------------------------------
  CN:CN38022/1-1295              ---------MTMIFFFLLLITCSLVSGAFG------------------------------
  BM:BM40734/1-1088              ------------------------------------------------------------
  WP:CE43668/1-1537              --------MRKRLLFLLILFSTC-SASPFPCGPSFVPCTQKRAFSSLIHSPNKQFNKEFG
  OV:OVP00967/1-1231             ------------------------------------------------------------
  SRP:SRP05421/1-1534            -MKIIINLWRNILIFIILFLSFFLIYSQIPCGKSFVSCENS------IFERKNAIDYNII
  PP:PP23975/1-1495              ---------MRLAQVFLLFIPAA-IASNIPCGKSFLACDYE-------------------
  BP:CBP00571/1-1491             --------MRRLVLYLLVFAGSSIVASNIPCGKSFIPCEND-------------------
  JA:JA48044/1-1261              ------------------------------------------------------------
                                                                                             
  
  
  SW:Q3UQ28/1-1475               ------------------------------------------------------------
  ENSEMBL:ENSP00000252804/1-1479 ------------------------------------------------------------
  FLYBASE:CG10211/1-1394         ------------------------------------------------------------
  RP:RP34620/1-1237              ----------------------------------------------RKFYEENYERAFQQ
  CN:CN38022/1-1295              ----------------------------------------------RNYHESNFDLASQA
  BM:BM40734/1-1088              ------------------------------------------------------------
  WP:CE43668/1-1537              VEFGKHFDSEPSEKVKNEFKKSMKQEIITTAASSAVRLTEKLFNDTEKLMSDKFDDSFKQ
  OV:OVP00967/1-1231             ------------------------------------------------------------
  SRP:SRP05421/1-1534            EGHIYKIDGSVTTTLTSNTNKILIDEDMILTASHQAEMALLNNMKEKKFIDKPNDKLIKD
  PP:PP23975/1-1495              SSKLKDTFSSIISKDSTTAQSTRIPDALFEAAAAEAKRETLALYNYSDVSLIHSAHRLWS
  BP:CBP00571/1-1491             ILNHQQGLNGI---DEGAFVSHRVPEGLLFVAAKEGERESSKLFDFRDVAFQYSGHPLST
  JA:JA48044/1-1261              ------------------------------------------------------------
                                                                                             
  
  
  SW:Q3UQ28/1-1475               -----------------VASKQGAGCPSRCLCFRTTVRCMHLLLEAVPAVAPQTSILDLR
  ENSEMBL:ENSP00000252804/1-1479 -----------------VAQKPGAGCPSRCLCFRTTVRCMHLLLEAVPAVAPQTSILDLR
  FLYBASE:CG10211/1-1394         -----------------LRIPEDLENAAINALSSERARSLTPCGSSAEAE-------GSV
  RP:RP34620/1-1237              AESEILPFRSQ--FSKDNSMMLNYSIAALAAIKVSKKIRDPSSPQKLPRH-------LCP
  CN:CN38022/1-1295              AQAEILPFRRHTPFSQEDSLMVNYSIAALTAIKVSQASSD--LHQKLPQH-------LCP
  BM:BM40734/1-1088              ------------------------------------------------------------
  WP:CE43668/1-1537              SELAWLHYTYADQYAKYLSFSAISSTLASQMISEKSPKTLKSMIQFLPTE-NTKMKEICP
  OV:OVP00967/1-1231             ------------------------------------------------------------
  SRP:SRP05421/1-1534            SIMRYIEVTSQEYQKNNLINGSNLNTALSKELKTMGLNLVDLKIIKIPENISNIMSEICI
  PP:PP23975/1-1495              SVEQYGRMHAIDDISFRQAKPAHVALAMTRKLTNLGMREKDLRFGVPSAVLANAIGEGCP
  BP:CBP00571/1-1491             STSQFTRIHKADKKASDRSRSAFTSVAITKRLTALGLRERELKYGLPPNQISSTISN-CP
  JA:JA48044/1-1261              ------------------------------------------------------------
                                                                                             
  
  
  SW:Q3UQ28/1-1475               FNRIREIQPGAFRRLRSLNTLLLN------NNQIKKIPNGAFEDLENLKYLYLYKNE---
  ENSEMBL:ENSP00000252804/1-1479 FNRIREIQPGAFRRLRNLNTLLLN------NNQIKRIPSGAFEDLENLKYLYLYKNE---
  FLYBASE:CG10211/1-1394         AGDYDVCPPSKYRQPTAECNNVSHRKWGARGDIFQRLLAADYADGVSQPR-TSKGTHALP
  RP:RP34620/1-1237              L-KKYKCSYGKYRHFDGRCTNVFSPLSGSTYSPFSRRLPANYDDGITLPRFHGYRNHLLP
  CN:CN38022/1-1295              L-KKYKCIYGDYRRFDGRCTNIFFPLSGSAYSSFSRRLLASYDDNISVPRFHGSRNRLLP
  BM:BM40734/1-1088              ------------------------------------------------------------
  WP:CE43668/1-1537              VNQIEECVIGKYRSYTGHCNNVKNPLNGASYERLKRFLPADYSDGISAPR-SSKSGQPLP
  OV:OVP00967/1-1231             ------------------------------------------------------------
  SRP:SRP05421/1-1534            KNKKNFCTPSSYRTINGECNNVNNPTLGSVYEPFQRILSPDYEDYIMLPR-SSYKKEQLP
  PP:PP23975/1-1495              ISSPLSCPPTEYRSFTGLCNNVNRPDSGAAHTPFARLVKPDYADGISSIR-ATSAGRPLP
  BP:CBP00571/1-1491             IPTINHCFATNYRSFSGICNNVAHPEWGASHTPMARIMRPDYADGVSEPR-AAAASKPLP
  JA:JA48044/1-1261              ------------------------------------------------------------
                                                                                             
  
  
  SW:Q3UQ28/1-1475               -IQSIDRQAFK------GLASLEQLYLHFNQIETLDPESFQHLPKLERLFLHNNRITHL-
  ENSEMBL:ENSP00000252804/1-1479 -IQSIDRQAFK------GLASLEQLYLHFNQIETLDPDSFQHLPKLERLFLHNNRITHL-
  FLYBASE:CG10211/1-1394         DAEVVIEQLQRHVEGELRHAHITAMLPAWGQLLANDLVEVGQLPISG------------K
  RP:RP34620/1-1237              PVDVVEKQVVKIPAK--FEIPLTPTFLDFSDFLYMDLARFVKLQ-----------DGVIG
  CN:CN38022/1-1295              PPGIVEKQIARVPAA--FPIPISKLFIEVSEFLYSDLASFVKIQ------------EGLG
  BM:BM40734/1-1088              ------------------------MFGKYFQ-----------------------------
  WP:CE43668/1-1537              SSRALS-ALFTPSPS--GHATCSLLIAPFLSFIYDDIVHVPSNRIFKRDFYGNDKAMPLP
  OV:OVP00967/1-1231             ------------------------------------------------------------
  SRP:SRP05421/1-1534            NERELTTKLFNYKND--RNVTISNLFAYWFHLISSDISLISSITKTS-----SGEDIIPQ
  PP:PP23975/1-1495              SPRGLSVSLFTPAGT--AHPEVTTLFAHWWQFLASDMIGVAPSQTVV-----SGDSSPLP
  BP:CBP00571/1-1491             SVRSLSLTLFTPRGE--VHSEVTTMMGLWMQLIASDMVNVVSFQAVN-----EGTSSALP
  JA:JA48044/1-1261              ------------------------MMALWMQLIASDMVNVVPFQAVN-----EGTSSALP
                                                                                             
  
  
  SW:Q3UQ28/1-1475               -VPGTFSQ-------LESMKRLRLDSNALHCDCEILWLAD-LLKTYAQSGNAQAAATCEY
  ENSEMBL:ENSP00000252804/1-1479 -VPGTFNH-------LESMKRLRLDSNTLHCDCEILWLAD-LLKTYAESGNAQAAAICEY
  FLYBASE:CG10211/1-1394         CCERDSAV------KDPSELQHCFVRAGPDCKEYKRSAPGFDLEACQKHTRQQMNIASAY
  RP:RP34620/1-1237              CCG---------------------------------------------------------
  CN:CN38022/1-1295              CCGSGSVG-------------ECLSIGDLFHDCYIRSAPS-PLKHCSLGQREQMNVATAF
  BM:BM40734/1-1088              ------------------------------------------------------------
  WP:CE43668/1-1537              CCRGDNSH--PECFEIPVPEDDTLQSKNVKCLPYSRSLPV-PNPKCSFGQRQQANMVTSY
  OV:OVP00967/1-1231             ---------------------------LTQCLPYVRTATS-PRENCSLGPREQVNQATSF
  SRP:SRP05421/1-1534            CCSPNTKKMDNECDPLEISSSDSIYRGLVTCIPYTRSIPT-IPKNCNLGQREQANFVTSY
  PP:PP23975/1-1495              CCRRGFTH--PECDTVDIPAADPAYRGRVSCIPHARSIVA-ARENCALGPREQANLASSF
  BP:CBP00571/1-1491             CCKRGFNH--SECDVIDIPAADPAYRTRLNCIPHSRSIIA-PREACRLGPREQANFASSY
  JA:JA48044/1-1261              CCKRGFNH--SECDVIDIPSADPAYRTRLNCIPHARSTIA-PREACRLGPREQANFASSY
                                                                                             
  
  
  SW:Q3UQ28/1-1475               PRRIQGRSVATITPEELNCERPRITSEPQD---------------------ADVTSGNTV
  ENSEMBL:ENSP00000252804/1-1479 PRRIQGRSVATITPEELNCERPRITSEPQD---------------------ADVTSGNTV
  FLYBASE:CG10211/1-1394         ---IDGSGLYGSTRHEFDQLRTYISGG------------------------VKVESCKYC
  RP:RP34620/1-1237              ---------------------------------------------------VTGRSGGEC
  CN:CN38022/1-1295              ---IDAGPIY-------QNWRDLSKGTIE----------------------SDFSLESSS
  BM:BM40734/1-1088              ---------------------------------------------------WHKNDG---
  WP:CE43668/1-1537              ---LDLSQIYGSTEGIVKKMRLHKNGKLALRAVGGFNNQLGVPPANLDSSICRSSTGKPC
  OV:OVP00967/1-1231             ---LDASHIYGSNVEHANKLRAYRDGLLLTQKSSRQNILLPTTNDGTC---WNNRNPQRC
  SRP:SRP05421/1-1534            ---IDGSSIYGISINNEKELREYVNGKLKTVIFNNDSELLSADITTSEW--CQLSSNYSC
  PP:PP23975/1-1495              ---LDASAIYGSTMERARKMRQFEFGLLRTWGGHGDLPDADSNIL------CTSQDG-RC
  BP:CBP00571/1-1491             ---LDASFIYGSNMEKAKQLRTFRNGQLRTAGSIGELPATDGTLQ------CQATHS-RC
  JA:JA48044/1-1261              ---LDASFIYGSNMERAKQLRTFRNGQLRTAGSIGELPATDGTLQ------CQATHS-RC
                                                                                             
  
  
  SW:Q3UQ28/1-1475               YFTCRAEGNPKPEI-----IWLRNNNELSMKTDSRLNLLDDGTLMIQNTQ----EADEGV
  ENSEMBL:ENSP00000252804/1-1479 YFTCRAEGNPKPEI-----IWLRNNNELSMKTDSRLNLLDDGTLMIQNTQ----ETDQGI
  FLYBASE:CG10211/1-1394         QVAGAT--------GALHRALLQQHNNIGERLSHINPDWSEEDVFLEARRIITATIQHIT
  RP:RP34620/1-1237              LNIGEQYAS------------LKSNYCIDRQFRSLN------------------------
  CN:CN38022/1-1295              SSSSLHSPSFSSPISSFHRLLIDEHNWVVQKLQKTYPGVQMNILFEEARKFVIAEVQHII
  BM:BM40734/1-1088              ------------------------------------------------------------
  WP:CE43668/1-1537              LLAGNNKINFLPTSGAIYTIWMRQHNVIADKLASVNPHWDDQKVFEEARRITIAQFQHIT
  OV:OVP00967/1-1231             FLAGGEFTNLFSTHTALHTIWLRQHNNIAKQLKAINADWDDEKLFQESRRIVIAQIQHIT
  SRP:SRP05421/1-1534            FKTGTKDGNIFPGSSTLRTILVKYHNYIAINLKKLNPFWDDEKIYQESKKIIIGKIQFIT
  PP:PP23975/1-1495              VLSGSTQANILPGVAAIHTIWIKQHNRVARQLRAMNTHWTDDKLYEEARKIVSAQLQHVT
  BP:CBP00571/1-1491             ALSGSDEVNILPSVAALHTVFIRHHNRLSDNLRSINRHWTDDKLYEETRKIVSAQIQHIT
  JA:JA48044/1-1261              ALSGSDEVNLLPSITALHTVFIRHHNRITDSLRSLNRHWTDDKLYEEARKIVSAQVQHIT
                                                                                             
  
  
  SW:Q3UQ28/1-1475               YQCMAKNVAGEAKTQEVTLRYLGSPARPTFVIQPQNTEVLVGESVTLECSATGHPLPQIT
  ENSEMBL:ENSP00000252804/1-1479 YQCMAKNVAGEVKTQEVTLRYFGSPARPTFVIQPQNTEVLVGESVTLECSATGHPPPRIS
  FLYBASE:CG10211/1-1394         YNEFLPLVLGQETTAKEGLRLTAEKHSSNYSSSVRGGIYNEFATAAMPAFWSMYP-----
  RP:RP34620/1-1237              -------LKAHILKEKYELRAAHCDGGSCHE--VEANTLNEYGSAVG-------------
  CN:CN38022/1-1295              FEQFLPILLGEETIEKYDLRAPHCDKELCHE--VEANTLNEYGSAVG-------------
  BM:BM40734/1-1088              -------------------------------IKILERSLNEY------------------
  WP:CE43668/1-1537              FNEMVPVLVGKEQLRVMGIKLQKNGYDSGYDINIDSSASNVFASAAGQFFLTLLPSQ-FN
  OV:OVP00967/1-1231             YNEFLPIIVGKNNLRQYGIKLRHSDYDSDYDLKTDATALNEYASAIGLFFYSLFSDHIFL
  SRP:SRP05421/1-1534            YNEFLPILLGEKNMIKYKLKLRNYGYESNYDITINSNVFNEVSILLNPLLFSMINEM-IR
  PP:PP23975/1-1495              YNEFLPILLGNDNIKRYGLNLHSAGFDADYDMNIDAAVLNEFAVTFPYVAWALLPSH---
  BP:CBP00571/1-1491             YNEFLPVLLGRENMRNYGLNLHSAGFDSNYEMNLEGTTFNEFAVTVPYYFWALLPSE-KS
  JA:JA48044/1-1261              YNEFLPILLGRENMRNYGLTLHSTGFDSNYEMNLEANTFNEFSVTVPYYFWALLPAE-GS
                                                                                             
  
  
  SW:Q3UQ28/1-1475               WTRGDRTPLPIDPRVNITPSGGLYIQNVAQSDSGEYTCFASNSVDSIHATAFIIVQALPQ
  ENSEMBL:ENSP00000252804/1-1479 WTRGDRTPLPVDPRVNITPSGGLYIQNVVQGDSGEYACSATNNIDSVHATAFIIVQALPQ
  FLYBASE:CG10211/1-1394         --------------------PEMLAKKMSAHELLSIAALQKSLVP---------------
  RP:RP34620/1-1237              ----------------------LFHKFMTTGD------KSQIFNPSLYSESSTSSS----
  CN:CN38022/1-1295              ----------------------LFHKFMTAADKSSFVLLKQIFNPSHYMATEFSTLQTSS
  BM:BM40734/1-1088              -----------------FNDPELLFSKDQTRDLLRYVLREPINESLTYTNDKFYNNFFKR
  WP:CE43668/1-1537              IEDKRFSTKS-ESLLKHFNDPALIYEKGRIDGMLKFLLNAPIEKPGLHSSPLLRTAFQKK
  OV:OVP00967/1-1231             HEDEEGNRKTKKSWSAIINNPELLYNG-KIDAILRYLLRETISKPGLHMNNYFKNEFLRG
  SRP:SRP05421/1-1534            LVDNKGWIIKNFNIGDTFNDPSLLYEKDGIENIIRFLTLEKINPPSLLIPEIFKSYYLSK
  PP:PP23975/1-1495              ------------SVTNAFNDPSKIYEPFGVETVLKTLMSITIAKPALRMNDEIKSEFLKN
  BP:CBP00571/1-1491             FVD--------------FNNPSRLYEQ-GPIQIIRQLLTTNIYQPALRANDEVKSGFLKD
  JA:JA48044/1-1261              FSD--------------FNNPSKLYEQ-GPVQILRQVLNTNIYQSTLRANDEVKSGFLKD
                                                          .                                  
  
  
  SW:Q3UQ28/1-1475               FTVTPQSRVVIEGQTVDFQCAAKGHPQPVIAWTK---------GGSQLSVDRRHLVLSSG
  ENSEMBL:ENSP00000252804/1-1479 FTVTPQDRVVIEGQTVDFQCEAKGNPPPVIAWTK---------GGSQLSVDRRHLVLSSG
  FLYBASE:CG10211/1-1394         ---SQTNAEGWSELALAVHRGRDHGVASYVHALDLCERRFADQSAANVSFDTLAQVSNIP
  RP:RP34620/1-1237              ---SGN----LKLSEILLK-GRDHGVATYAEWRKECG------GGEVTSYEQL-IGLIDD
  CN:CN38022/1-1295              ---TASDVLSPKLSELILR-GRDHGIATYAQWRKECG------GGELESYEQL-IGMIDD
  BM:BM40734/1-1088              ---NKN--LASEFIALILQMGRDHGIPPYTVWREYCN------GSKIQSFDDLMDDLIDG
  WP:CE43668/1-1537              ---DIA--DSVDIIAMVIQMGRDHGLPSYLQWRTFCK------LDDFSSFLAL-QTIFKP
  OV:OVP00967/1-1231             ---KGN--YGLDLAAMIIQMGRDHGVPGYTAFRSACG------LRQPANFSDL-ADIILE
  SRP:SRP05421/1-1534            ---RGN--FGLDSISLAIKKGRDHGIKGYRFYRQACG------LSDITNFNDL-EKIFYS
  PP:PP23975/1-1495              ---KRDDGYGMDLVSIAIKQGRDHGVPGYTTVRANCG------LGKIRYFGDL-SEVFHE
  BP:CBP00571/1-1491             ---NHE--FGLDLISIALKQGRDHGIPGYTAIRASCG------LGRIASFNDL-REIFLP
  JA:JA48044/1-1261              ---NHE--FGLDLVSIALKQGRDHGIPGYTTIRATCG------LGRIASFNDL-REIFLP
                                            .   : .:   .                                     
  
  
  SW:Q3UQ28/1-1475               TLRISGVA-LHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDMTVEVGTNVQL
  ENSEMBL:ENSP00000252804/1-1479 TLRISGVA-LHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPVFASIPSDTTVEVGANVQL
  FLYBASE:CG10211/1-1394         EEYITNLRDIYQNANDIDLLVGALLEEPVVGALF-----GPTISCL-------LSLQFEQ
  RP:RP34620/1-1237              RI-LKSVRDLFPDIRDVDLILLGVAENPVYGSLL-----GPTFGCI-------MALQFQK
  CN:CN38022/1-1295              RI-LKSVRDIFPDIRDVDLIILGVAENPVYGSLL-----GPTFGCI-------MALQLQK
  BM:BM40734/1-1088              TEMIKELSKLYKTVDDMDLFLLGLIEKPLNDAIV-----GPTFSCI-------ISLQFQK
  WP:CE43668/1-1537              SVNISDFERLYESPEDIDVFVGGLSEQPTKGSLL-----GPTFACL-------FAHQMAQ
  OV:OVP00967/1-1231             SLDLDELAKLYDHIDDVDLFVLGMAEKPEVGALV-----GPTFACI-------IGKQFQK
  SRP:SRP05421/1-1534            KDVVNILSSLYDNINDVELIIGSLGEKPIDGSLL-----GPTLSCI-------LGKQFEI
  PP:PP23975/1-1495              EVRSEYITTIYDAVEDIDLLVGILAEKPLKGALV-----GPTLACL-------ASKQFQR
  BP:CBP00571/1-1491             EVKFEHLSAAYSRVEDVDILVGVLAEKPLKGSLV-----GPTMACI-------IGKQMQR
  JA:JA48044/1-1261              EVKFEQVASAYERVEDIDLLVGVLAEKPLKGSLV-----GPTMACI-------IGKQMQR
                                       .   .         :  : .:     :       *.:..:        . :.  
  
  
  SW:Q3UQ28/1-1475               PC------------SSQGEPEPAITWNKDGVQVTESGKFHISPEGFLTINDVGTADAGRY
  ENSEMBL:ENSP00000252804/1-1479 PC------------SSQGEPEPAITWNKDGVQVTESGKFHISPEGFLTINDVGPADAGRY
  FLYBASE:CG10211/1-1394         --------------LKQTDRF----WYENEIPPSSFTLDQLKSIRQTTLSGLLCGSHQ-V
  RP:RP34620/1-1237              --------------TKFGDSY----WYTN-----KLNDEQLEEVKKVSISGLMCRNQK-T
  CN:CN38022/1-1295              VIFEAQPNINALLQTKFGDSY----WYTN-----RLNKEQIEEVEKVSISGMI-------
  BM:BM40734/1-1088              --------------TKTGDRY----WYENNFEEIRFSDEQLMEIRKITMAKIFCSNVKSF
  WP:CE43668/1-1537              --------------TKRGDRF----WYENFVSPSAFTVDQIDEIRKTTMARIICDNTDTV
  OV:OVP00967/1-1231             --------------IRRGDRF----WYENFFAPSAFTLEQLGEIRKTTLARIVCDNLEGI
  SRP:SRP05421/1-1534            --------------LKYGDRY----WFENYFTDSSFTIKQLDEIRKSSISEIICVGSN-I
  PP:PP23975/1-1495              --------------TRRGDRF----WYENYFTPSSFSEKQLDEIRKTKLAEIICANSD-A
  BP:CBP00571/1-1491             --------------TRRADRF----WYENYFAQSGFSEGQLSEIRNTKLAEIICANID-I
  JA:JA48044/1-1261              --------------TRRADRF----WYENYFAQSGFTEAQLSEIRNTKLAEIICSNVD-I
                                                   :      *  :          ::      .:  :        
  
  
  SW:Q3UQ28/1-1475               ECVARNTIGYASV-----------------------------------------------
  ENSEMBL:ENSP00000252804/1-1479 ECVARNTIGSASV-----------------------------------------------
  FLYBASE:CG10211/1-1394         STAQSKAFILEDNYL---------------------------------------------
  RP:RP34620/1-1237              SIIQKDGFRAPDNFQCTISHDKMHKFSKFQENMFLHPKNFRKPNFKVKIAVNWRFQLIST
  CN:CN38022/1-1295              ------------------------------------------------------------
  BM:BM40734/1-1088              DKIQSKVFELENDYD---------------------------------------------
  WP:CE43668/1-1537              THVQHHAFSLPDDYG---------------------------------------------
  OV:OVP00967/1-1231             NEIQPNVFTLADIYG---------------------------------------------
  SRP:SRP05421/1-1534            NSLQPNTFLLPDKFS---------------------------------------------
  PP:PP23975/1-1495              RRIVPRVFMLENIFE---------------------------------------------
  BP:CBP00571/1-1491             RRIQRNVFFREDEFD---------------------------------------------
  JA:JA48044/1-1261              RRIQRNVFFREDVFD---------------------------------------------
                                                                                             
  
  
  SW:Q3UQ28/1-1475               ---------SMVLSVN------VPDVSRN--------------GDPYV-ATSIVEAIATV
  ENSEMBL:ENSP00000252804/1-1479 ---------SMVLSVN------VPDVSRN--------------GDPFV-ATSIVEAIATV
  FLYBASE:CG10211/1-1394         ---------NSILDCD---QLPKFDLKPWQVNPEDEVHVEHVEVEPATKEAIAELSPELI
  RP:RP34620/1-1237              DFSINFCSRNIPIFCNSS-VFSQPDFSKW--------------FRPEK-----QLRTAQF
  CN:CN38022/1-1295              ---------NIPLFCNSS-VFSMPDFTKW--------------IATDE-----KPRNSEF
  BM:BM40734/1-1088              ---------NYPIYCNET-VHADTNIAKW--------------LDKSNYKLNLPLTEEKI
  WP:CE43668/1-1537              ---------NCPLSCNSTGIIQVFDPKAF--------------KDEEK-LTSLPITKETV
  OV:OVP00967/1-1231             ---------NCPMHCNST-IIDTIDLTQW--------------IDQEP-RLKLPITKATL
  SRP:SRP05421/1-1534            ---------NTFLNCNNN-AINKMKFKYW--------------KDDEK-KIEIPITKETI
  PP:PP23975/1-1495              ---------NNPISCNATGLMSSPHFDAW--------------RDKEI-ITRFPVKTETI
  BP:CBP00571/1-1491             ---------NMAISCNST-VLSSPNFNEW--------------RDAEG-KPVFPIRQETI
  JA:JA48044/1-1261              ---------NMAISCNSS-VLSGPNFNEW--------------RDAEG-KPVFPIRQETI
                                          .  :  :        .                                  .
  
  
  SW:Q3UQ28/1-1475               DRAINSTRTHLFDSRPRSPN----------------------------------------
  ENSEMBL:ENSP00000252804/1-1479 DRAINSTRTHLFDSRPRSPN----------------------------------------
  FLYBASE:CG10211/1-1394         EAAVERAKQELEERKRFEYEVWRTKGGI--------------------------------
  RP:RP34620/1-1237              DSILGECIRDVSESRRRRQS----------------------------------------
  CN:CN38022/1-1295              DDVLDECTLEVKRARSYRK-----------------------------------------
  BM:BM40734/1-1088              EKAIEIAIEGVKQRQKRERRNIRKNQDLFKSDDPLLSFLDQNLFKSDDPLPSFLDQDLFK
  WP:CE43668/1-1537              EKVIRLGLRQWQRYEEGEGRRI--------------------------------------
  OV:OVP00967/1-1231             EKAVRLGAEHAKRLNEAEADRIRRQGR---------------------------------
  SRP:SRP05421/1-1534            EKVFDLAELNVKERIKRELKNINVN-----------------------------------
  PP:PP23975/1-1495              AKVIRLAATNLKDQAKREISNIKHN-----------------------------------
  BP:CBP00571/1-1491             EKVISLAKRNLKDQERREISNLKHN-----------------------------------
  JA:JA48044/1-1261              EKVITLAKRNLKDQERREISNLKHN-----------------------------------
                                    .                                                        
  
  
  SW:Q3UQ28/1-1475               ----------------------------------DLLALFRYPR----DPYTVGQARAGE
  ENSEMBL:ENSP00000252804/1-1479 ----------------------------------DLLALFRYPR----DPYTVEQARAGE
  FLYBASE:CG10211/1-1394         -------------------------SARSPDG--------TAASFSKANLAALNLANSSL
  RP:RP34620/1-1237              -------------------------SGNLREGLHNSVALKSYGSMMLAKDEAVNEANISF
  CN:CN38022/1-1295              -------------------------PKTLQDGLHDSVALKSYGSMMLAKDEAVNEANISF
  BM:BM40734/1-1088              SDDPLLSFSDQDLFKSDDPLPPFLDQDLFKSG--DP--LLSYGKMMRAKNEAIAISRVSD
  WP:CE43668/1-1537              -------------------------SAQLSDS--SPSALLSHALLMAPKKESIDIARTAS
  OV:OVP00967/1-1231             -------------------------SGNANRS--QKLAVYAHSNLLAPKKESLEISHRAE
  SRP:SRP05421/1-1534            -------------------------QTNFQKG--DP--LYAWSNMLRPKERSKEIGKIAE
  PP:PP23975/1-1495              -------------------------QKEFQKG--DP--LFAYSNMMRAKPHAKTVSQISA
  BP:CBP00571/1-1491             -------------------------QGRFQKG--DP--LFAYSNMMRAKEGAKQVSQISA
  JA:JA48044/1-1261              -------------------------QGRFVKG--DP--LFAYSNMMRAKEGAKQVSQISA
                                                                                 .  :   .. . 
  
  
  SW:Q3UQ28/1-1475               IF--ERTLQLIQEHVQHGL----------MVDLNGTSYHYNDLVSPQYLSLIANLSGCTA
  ENSEMBL:ENSP00000252804/1-1479 IF--ERTLQLIQEHVQHGL----------MVDLNGTSYHYNDLVSPQYLNLIANLSGCTA
  FLYBASE:CG10211/1-1394         IFELTSNEIVKTLNHITRRKRQIFNPNQNAFNRNELTDTLQTVDISGLLG--------GA
  RP:RP34620/1-1237              IL-LEATRKLITGDRN-------------VVDLERIQGI--------YIG------ETFG
  CN:CN38022/1-1295              IL-LEATKKLVKHK---------------NVALSSIQGV--------YIG------EGDK
  BM:BM40734/1-1088              VF-LQATKNILSIIGTENNKELLG----EVNDINEMQNLLQQIDVSSFISRIEPFLGRGG
  WP:CE43668/1-1537              VL-REATNILISGNGLDKDERLP------DLDIGTLQKILPQIDVGSVIGNFTPFLARD-
  OV:OVP00967/1-1231             VL-REATKVLLRGDGLSEQERLPL-----ELDLPTLQRLLPEVDVSYFVGNITDFLGEEN
  SRP:SRP05421/1-1534            IL-LESTKILINNNNLPGGEKLP------KLSIEHIQKMLPEIDVSRFIFNYTAFLSDNG
  PP:PP23975/1-1495              VL-LETTKLLVKGEMLHEDEKLP------PLDSATLATILPEIDVSSFVNNYTAFLSVDG
  BP:CBP00571/1-1491             LL-LETTKLLIKGEGLDTDEQLP------KLDTNTLQKILPDIDVTSFVNNYTAFLSEDG
  JA:JA48044/1-1261              LL-LETTKLLIKGEGLDTDEQLP------KLDTNTLQKILPDIDVTSFVNNYTAFLSEDG
                                 ::    .  :                                      :           
  
  
  SW:Q3UQ28/1-1475               HRRVNNCSDMCF----HQKYRTHDGTCNNLQHPMWGASLTAFERLLKAVYENGFNTPRGI
  ENSEMBL:ENSP00000252804/1-1479 HRRVNNCSDMCF----HQKYRTHDGTCNNLQHPMWGASLTAFERLLKSVYENGFNTPRGI
  FLYBASE:CG10211/1-1394         QKQLDTCPEPSQQCDANSPFRTLSGRCNNLRNPNWGKSLTTFSRLLPAQYEDGISAPR--
  RP:RP34620/1-1237              KKSDELCNPKDFPCDPTNPYRTYTGWCNNLATPSLGNTFRELKRLLPPAYEDGIDLPR--
  CN:CN38022/1-1295              YNVSDQCTPKDLPCDSTNPYRSYTGWCNNLEFPSYGNTFRELKRLLPPDYDDQIDLPR--
  BM:BM40734/1-1088              --SVEKCLPRNLPCDDVTRYRTMSGWCNNLQNPRFANAFGPLIHLLPPAYDDGIDMPR--
  WP:CE43668/1-1537              PLPKEQCLPEPLPCDHTSKYRTYSGWCNNLKNPKFGNAFTQMRRLLDPAYDDGFDTPR--
  OV:OVP00967/1-1231             P-SIEECLPRPLPCDHTTKYRTFSGWCNNLKFPHYGNAFAPMRRLLDPVYEDGFDSPR--
  SRP:SRP05421/1-1534            RLTKDQCLPQNLPCDHTNKYRIYSGWCNNLKHPEYGNAFQPLKHLLTPVYDDGFDKPR--
  PP:PP23975/1-1495              QSTEEECLPRMLPCDHTTRYRSYNGWCNNLRFPHYANSFGPLRHLLPPQYDDGFDVPR--
  BP:CBP00571/1-1491             QASQEECSPKMLPCDHTTRYRTFNGWCNNLKFPEYANSFAPLRHVLPPQYEDGFDAPR--
  JA:JA48044/1-1261              QSSQEECSPKMLPCDHTTRYRTFSGWCNNLKFPEYANSFAPLRHLLPPQYDDGFDAPR--
                                     : *            :*   * ****  *  . ::  : ::* . *:: :. **  
  
  
  SW:Q3UQ28/1-1475               NSQRQYNGHVLPMPRLVSTTLIGTEVITPDEQFTHMLMQWGQFLDHDLDSTVVAL-SQAR
  ENSEMBL:ENSP00000252804/1-1479 NPHRLYNGHALPMPRLVSTTLIGTETVTPDEQFTHMLMQWGQFLDHDLDSTVVAL-SQAR
  FLYBASE:CG10211/1-1394         -LTGV-TGTALPNPRTISTTIHPDISNL-HTRYSLMVMQFAQFVDHDLTLTPIHKGFHES
  RP:RP34620/1-1237              -SKTT-TGAPLPSPRVISNTVHHAKKIE-HVKYSHFVMEFGQFIDHDITHSPVDQNPDGT
  CN:CN38022/1-1295              -SKST-SGARLPSPRAISNVVHHSKKIE-HVKYSHFVMEFGQFIDHDITHSPVDQNSDGT
  BM:BM40734/1-1088              -SKSI-TGDLLPSARVISNAIHFDLPIT-YQNYSHMIMQFGQILDHELTHSPIEHGPDNE
  WP:CE43668/1-1537              -TRSV-LGSELPSARKISNIVHSDAPKF-HVKFTHMLMQFGQILDHDMMHSPISRGPKNT
  OV:OVP00967/1-1231             -IMSRNRGRKLPSARKVSNAVHAEAPVF-HAVYTHMLMQMGQIIDHDFAHSPVSRGPGNA
  SRP:SRP05421/1-1534            -IKSI-TGKLLPNPRIISNKIHEDKNIS-HVKFTHMVMQFGQFLDHDLTHSPTSRGPNNE
  PP:PP23975/1-1495              -WRAK-SGKSLPNPRKVSNVVHEDKDVS-HVKFTHMVMQFGQLLDHEMTHSPVARGPNDE
  BP:CBP00571/1-1491             -TRAK-SGRPLPNPRRVSNLVCEDKDVS-HVKFTHMVMQFGQLLDHELTHSPVARGPNDE
  JA:JA48044/1-1261              -TRAK-SGRPLPNPRRVSNSVCEDKDVS-HVKFTHMVMQFGQLLDHELTHSPVARGPNDE
                                        *  ** .* :*. :           :: ::*: .*::**::  :         
  
  
  SW:Q3UQ28/1-1475               FSDGQHCSSVCSNDPPCFSVMIPPNDPRVR------SGARCMFFVRSSPVCGSGMTSLLM
  ENSEMBL:ENSP00000252804/1-1479 FSDGQHCSNVCSNDPPCFSVMIPPNDSRAR------SGARCMFFVRSSPVCGSGMTSLLM
  FLYBASE:CG10211/1-1394         IPSCRPCNSRQTVHPECNPFPVPAGDFYYPEVNVTSGERFCFPSMRSLPG---------Q
  RP:RP34620/1-1237              PLNCSRCDSSHTVSPSCFPIAIPETDLHFA-PF------SCLSFVRSLPA---------Q
  CN:CN38022/1-1295              PLNCSKCDSNRDISPSCFPIPVPVNDLHFE-PY------SCLSFVRSLPA---------Q
  BM:BM40734/1-1088              ILNCTRCDSNEILSMHCMPLPIPLNDPFFP-IYDENGKRRCLPFTRSLLG---------Q
  WP:CE43668/1-1537              ILNCSSCDSAQTLSIHCFPIKIEANDPFFP-SKHSDGRPRCMPFARSLLA---------Q
  OV:OVP00967/1-1231             ILDCSRCDSAKTVSIHCFPIPIESGDPYFP-HLLDNGEPRCIAFTRSLLG---------Q
  SRP:SRP05421/1-1534            ILNCTRCDSPETISVHCSPIPIEIGDPHFP-THYPNGEKRCLPFARSLLG---------Q
  PP:PP23975/1-1495              ILNCTRCDSPDKISVHCMPIRVESDDPFFP-THYPNGEPRCLPFARSLLG---------Q
  BP:CBP00571/1-1491             ILNCTKCDSPEKISVHCMPIRVEKDDPFFP-TNYPNGEPRCLPFARSLLG---------Q
  JA:JA48044/1-1261              ILNCTKCDSPEKISVHCMPIRVEKDDPFFP-THYPNGEPRCLPFARSLLG---------Q
                                   .   *..       * .. :   *              *:   **             
  
  
  SW:Q3UQ28/1-1475               NSVYPREQINQLTSYIDASNVYGSTDHEARSIRDLASHRGLLRQGIVQ----RSGKPLLP
  ENSEMBL:ENSP00000252804/1-1479 NSVYPREQINQLTSYIDASNVYGSTEHEARSIRDLASHRGLLRQGIVQ----RSGKPLLP
  FLYBASE:CG10211/1-1394         QSLGPRDQINQNTHFLDGSMVYGETTCLSNKLRGFS---GRMNSTQVR------GKELLP
  RP:RP34620/1-1237              KTLGYRNQMNQVSAFLDGSVMYGSTKCEGDRLRTFQ--DGKMKTTQISNAKRHYGITLSQ
  CN:CN38022/1-1295              KTLGHRNQMNQVSSFLDGSVMYGSTKCEGDRLRTFQ--DGKMKTTRISNSRRHYGITLSQ
  BM:BM40734/1-1088              LNLGYRNQINQLTAYLDGSAIYGSTECEMKELRTFV--GGRLNSTNLG----IFNPEALP
  WP:CE43668/1-1537              VSLGFRNQLNQLTSFLDASTIYGSTQCEANKLRLFS--DGKLNFTDLG-----FNKEALP
  OV:OVP00967/1-1231             LTLGYRNQLDQLTSYIDASFIYGSTECEANKLRLFS--QGLLNFTDLG-----FNREALP
  SRP:SRP05421/1-1534            LNLGYRNQLNQLTSFIDGSAIYGSTDCEANQLRFFS--KGLLKYSNIG----LHNTEALP
  PP:PP23975/1-1495              LNLGYRNQMNQLTSYIDGSVLYGSTKCEAKELRLFT--RGLLNFTDFG-----HGEFMLP
  BP:CBP00571/1-1491             LNLGYRNQLNQLTAYVDGSAIYGSTKCEAKALRLFT--RGLLNFTDFG-----HGQMMLP
  JA:JA48044/1-1261              LNLGYRNQLNQLTAYVDGSAIYGSTKCEANNLRLFT--RGLLNFTDFG-----HGQMMLP
                                  .:  *:*::* : ::*.* :**.*      :* :    * :.   .       .     
  
  
  SW:Q3UQ28/1-1475               FATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIAAELLKLNPHWD
  ENSEMBL:ENSP00000252804/1-1479 FATGPPTECMRDENESPIPCFLAGDHRANEQLGLTSMHTLWFREHNRIATELLKLNPHWD
  FLYBASE:CG10211/1-1394         LGPHPE--CKSRNGL----CFLGGDDRASEQPGLTAIHTAFLREHNRIVEGLRGVNPHWN
  RP:RP34620/1-1237              SDESEQDGCVSSPEA---PCFIAGDDRNSQQTLLIAVHSVFHREHERVSSKFKDLNPHWD
  CN:CN38022/1-1295              SDEAEQDGCVSSPEA---PCFIAGDDRNSQQTLLIAVHTIFHREHERLATLLKEMNPQWE
  BM:BM40734/1-1088              QGDQEQD-CRSKPDF---MCFVAGDERNSHQPGLTSMHNIFLREHNRIARKLEEMNPFWN
  WP:CE43668/1-1537              QGNQERD-CRSVLQNRQRRCFVAGDERSNEQPGLTAIHNIFLREHNRIARYLKQINNFWS
  OV:OVP00967/1-1231             QGRQERD-CRSQPRH---PCFNAGDERSNEQPGLTVMHTLFLREHNRIAASLSRINNFWS
  SRP:SRP05421/1-1534            QGEQEKD-CRSLPKY---KCFVSGDERNSHQPGLTMMHTIFMREHNRIVKKLSIINPHWN
  PP:PP23975/1-1495              QGPQERD-CRSLPHS---PCFVAGDERNSHQPGLTVMHTMFMREHNRIAMQLSAMNPHWS
  BP:CBP00571/1-1491             QGNQEKD-CRSTLEKRSMPCFVAGDERNSHQPGLTIMHTFMVREHNRIAMQLSALNPHWN
  JA:JA48044/1-1261              QGNQEKD-CRSSQEKRSMPCFVAGDERNSHQPGLTVMHTFMVREHNRIAMQLSALNPHWN
                                         *          ** .**.* ..*  *  :*.   ***:*:   :  :*  *.
  
  
  SW:Q3UQ28/1-1475               GDTVYHETRKIVGAEIQHITYRHWLPKILG-------EVGMKMLGEYRGYDPSVNAGIFN
  ENSEMBL:ENSP00000252804/1-1479 GDTIYYETRKIVGAEIQHITYQHWLPKILG-------EVGMRTLGEYHGYDPGINAGIFN
  FLYBASE:CG10211/1-1394         GEQLFHHARKIVSAQVQHIVFNEFLPRILSWNAVNLYGLKLLPQGYYKDYNPSCSPIVFN
  RP:RP34620/1-1237              DERIYQETRKLISAQFAHIVYHEYLPIVIGQKLMDDFDLRPRQDGYYGGYDAKCDASILQ
  CN:CN38022/1-1295              DEQIYQETRKLISAQFSHIVYNEYLPIIIGQKLIDEYGLRPKRDGYFTGYEN-CDASILQ
  BM:BM40734/1-1088              DERIFQETRRIVGAEFAHITYNDYLPLLLGNRLMHKYDLNTHKIGYYHGYDDQCDASISH
  WP:CE43668/1-1537              DEKLFQESRRINIAQLQHIIYKEWLPVVLGCQNMEKWGLMPQTAGYFEGYDDQCDATISQ
  OV:OVP00967/1-1231             DEKIYLETRRIMGAKIQHIVYNEWLPIVLGCEATARYDLVPRKTGYYKGYDDKCDPTMTQ
  SRP:SRP05421/1-1534            DEKLYQEGRRIQIGQFQHIVFSEFIPKIIGIKLLDKYDIMVKKDGYYKKYDETCDPQISQ
  PP:PP23975/1-1495              DEVVYQESRRIVVAIMQQITFAEFLPKVVGSDLLEQENLVPLKNGYFSGYDESCDASISQ
  BP:CBP00571/1-1491             DDTVFEETRRIVVAEMQHITFAEFLPKIIGLDLLNAQNLVPKKNGYFGGYDETCDASISQ
  JA:JA48044/1-1261              DDTVFEETRRIVVAEMQHITFAEFLPKIIGLDLLNAENLVPKKNGYFDGYDDTCDASISQ
                                 .: :: . *::  . . :* : .::* ::.        :     * :  *:   .. : :
  
  
  SW:Q3UQ28/1-1475               AFATAAFRFGHTLINPLLYRLDENFEPIPQGHVPLHKAFFSPFRIV--NEGGIDPLLRGL
  ENSEMBL:ENSP00000252804/1-1479 AFATAAFRFGHTLVNPLLYRLDENFQPIAQDHLPLHKAFFSPFRIV--NEGGIDPLLRGL
  FLYBASE:CG10211/1-1394         EFAAAAFRIGHSLLRPHIPRLSVQHQPVEP-PLLLRDGFFRMDALL--QPGIIDEILRGL
  RP:RP34620/1-1237              PFATAAFRFGHSTVTRFTPMQETVLEPATR-VVDLAADFLNMSKIYS-ETDAVEQILGGM
  CN:CN38022/1-1295              PFATAAFRFGHSTVTRFTPMQETVHSPATR-VVDLASDFLNMSKIY--NDDAVEKILGGM
  BM:BM40734/1-1088              PFATSAFRFGHTLVRRFFPRFNAFYKNFTE-PIDLVENFNSVEAIYDGKRGSIDSLIIGL
  WP:CE43668/1-1537              EMSTSAFRFGHSLIRGVFTRMNDNFQNMTN-HVNLTETFSNPSPVYDKNSGHMESILMGL
  OV:OVP00967/1-1231             EMATAAFRFGHSLIRNIFPRMNAEYKEETD-GLDLKASFNNETFYYSLETGHIESVIMGL
  SRP:SRP05421/1-1534            PFATAAYRFGHTLIRRLFPRLDKNFKEISD-PIDISTHFGHVEPIYNGTAGGIDSIIMGL
  PP:PP23975/1-1495              PFATAAFRFGHTLIRRMFPRMTNAYKNMTE-KVDLAMHFGHVGPLYDHKQGGLDTMLMGL
  BP:CBP00571/1-1491             PFATAAFRFGHTLIRRMFPRMNYNYKNMSE-PVDLAQHFGHVGPLYEQEKGGMDAMLMGL
  JA:JA48044/1-1261              PFATAAFRFGHTLIRRMFPRMNYNYKNMSE-PVDLAQHFGHVGPLYEQDKGGLDAMLMGL
                                  ::::*:*:**: :           .      : :   *           . :: :: *:
  
  
  SW:Q3UQ28/1-1475               FGVAGKMRIPSQLLNTELTERLFSM--AHTVALDLAAINIQRGRDHGIPPYHDYRVYCNL
  ENSEMBL:ENSP00000252804/1-1479 FGVAGKMRVPSQLLNTELTERLFSM--AHTVALDLAAINIQRGRDHGIPPYHDYRVYCNL
  FLYBASE:CG10211/1-1394         VATPMET--LDQFITGEVTNHLFEDRKIPFSGIDLIALNIQRARDHGIPSYNNYRALCNL
  RP:RP34620/1-1237              HAKHQMM--TDRFVDDAVRNFLFSDRGRRGTGLDLIAINIQRGRDHGIPPYNHYRTFCGL
  CN:CN38022/1-1295              HAKNQMM--TDRFVDDAVRNFLFSDRGRRGTGLDLIAINIQRGRDHGIPSYNHFRDFCGF
  BM:BM40734/1-1088              LGAPSMA--FDRHITTALRNHLFGRRGEPFSGMDLISLNILRARDHGVQPYNAFRELCGI
  WP:CE43668/1-1537              IGANSMA--FDRHIVTAVRNHLFAKPGGPLTGLDLPAVNIQRGRDHGVQGYNAYRKHCGL
  OV:OVP00967/1-1231             LGSHSMG--FDRYISDAVRNHLFQKSSNPYTGMDLPALNIQRGRDHGIPPYNSYREMCGM
  SRP:SRP05421/1-1534            LGTPSMA--FDRHITSAVRNHLFARRGEKTSGMDLIAINILRARDHGVQSYNTFREFCGF
  PP:PP23975/1-1495              LGTPSMA--FDRHITNAVRNHLFMRRGEPTSGMDLIAINMLRARDHGVQPYNDLREFCGL
  BP:CBP00571/1-1491             LGTPSMA--FDRHITDAVRNHLFMRRGEKTSGMDLIVLNILRARDHGVQPYNDLREFCGL
  JA:JA48044/1-1261              LGTPSMA--FDRHITDAVRNHLFMRRGEKTSGMDLIVLNILRARDHGVQPYNDLREYCGF
                                  .        .: :   : : **        .:**  :*: *.****:  *:  *  *.:
  
  
  SW:Q3UQ28/1-1475               SAAYTFEDLKNEIKSPVIREKLQRLYGSTLNIDLFPALMVEDLVPGSRLGPTLMCLLSTQ
  ENSEMBL:ENSP00000252804/1-1479 SAAHTFEDLKNEIKNPEIREKLKRLYGSTLNIDLFPALVVEDLVPGSRLGPTLMCLLSTQ
  FLYBASE:CG10211/1-1394         KRATNWNDLSREIPTEVI-NRFQKIYASVDDIDLFPGAMTERPLQGGLVGPTLACIIGIQ
  RP:RP34620/1-1237              SRLTSFYSIFSDIDQDGL-TAIGKVYESPDDIDLFTGIVAEKTVPGGIVGPTAACIIAEQ
  CN:CN38022/1-1295              PRLTSFYSIFSDIDQDGL-TAIGKVYESPDDIDLFTGIISENVVPGAIVGPTASCIIAEQ
  BM:BM40734/1-1088              GKAKDFDDLLNEMDESAV-IALKNLYKTVDDIDLFPGLLCEKPMEDALLPPTMACIIAEQ
  WP:CE43668/1-1537              RKASAFSDLRDVMNSEAV-TALETAYAHVDDIDLFPGIMSESPTRGSLVGPTLACLIGEQ
  OV:OVP00967/1-1231             HRARNFDDLKDVMDDRTI-AAFRNVYDHVDDIDLFPGMMSERPLKGALVGPMLTCIIGEQ
  SRP:SRP05421/1-1534            KKATNFNDLLNDMDSETV-FSLQSVYEDVNDIDLFPGLISEKPLRGALLGPTMACLIAEQ
  PP:PP23975/1-1495              PRAKRFEDLKNEIDDAGI-KALQSVYEHVDDIDLFPGLVSEAPRKGALLGTTMSCILAEQ
  BP:CBP00571/1-1491             RRAVKWEDLRSEMDQDNI-NILQSLYESVDDIDLFPGLVSERPLRGALLGTTMSCIIAEQ
  JA:JA48044/1-1261              KRAVTWDDLRVEMDQDNI-NILQTLYESVDDVDLFPGLVSERPLRGALLGSTMSCIIAEQ
                                      : .:   :    :   :   *    ::***.. : *    .. : .   *::. *
  
  
  SW:Q3UQ28/1-1475               FRRLRDGDRLWYENPG---VFSPAQLTQLKQ-TSLARILCDNSDNITRVQQDVFRVAE-F
  ENSEMBL:ENSP00000252804/1-1479 FKRLRDGDRLWYENPG---VFSPAQLTQIKQ-TSLARILCDNADNITRVQSDVFRVAE-F
  FLYBASE:CG10211/1-1394         FRQLRKCDRFWYENQNPEVKFTEAQLAEVRK-VTLAKIVCENLEITGDMQRAAFDLPSNF
  RP:RP34620/1-1237              FRRLKKCDRFYYENEK---RFSVEQLKEIRTATTMSALICGNTK-VSKIAKDVFSVPEPF
  CN:CN38022/1-1295              FRRLKKCDRFYYENGMEHTKFSTDQLKEIRK-VTMSSLICSNTK-IPKISKDVFSVPDPI
  BM:BM40734/1-1088              FQRLKKCDRFYYENDLHAIRFSPMQLNEIRK-VTLSSLLCANSRMLRNIQPNVFLLPDQF
  WP:CE43668/1-1537              MQRLKKCDRFYYETSDSMVRFTPDQLVEIRK-ASLSRIICDNSEYAANIQPNVFLMPDDL
  OV:OVP00967/1-1231             FQRLKRCDRFFYENDNPATKFTPDQLAEIRK-TTLSKLICANSQYARRIQPNAFLMPDDL
  SRP:SRP05421/1-1534            FSRLKKCDRYYYENNNEVTKFTLRQLREIRK-IKLSTIFCQNSNYIKTIQPNVFDMPDDL
  PP:PP23975/1-1495              FGRLKRCDRFYYENDNVAAKFTPNQLNEIRK-IRLASIFCANSKYLKTIQPNVFDIPDDL
  BP:CBP00571/1-1491             FGRLKRCDRFYYENDNNAAKFTPAQLNEIRK-VKLASIFCSNSKYMKTIQPNVFDVTDEL
  JA:JA48044/1-1261              FARLKRCDRFYYENDNNAAKFTPAQLNEIRK-VKLASIFCSNSKYLKTIQPNVFDVTDDL
                                 : :*:  ** :**.      *:  ** :::    :: :.* *      :   .* :.. :
  
  
  SW:Q3UQ28/1-1475               PHGYSSCEDIPRVDLRVWQDCCEDCRTRGQFNAFSYHFRGRRSLEFSYEDDKPTKRARWR
  ENSEMBL:ENSP00000252804/1-1479 PHGYGSCDEIPRVDLRVWQDCCEDCRTRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPR
  FLYBASE:CG10211/1-1394         LNPRVPCASMPQIDLNAWRENVQGCQIGNR------------------------------
  RP:RP34620/1-1237              GNPLIDCDLYPKLDLSKWRDA-KDCVHKGK------------------------------
  CN:CN38022/1-1295              GNPIINCDFYSKLDLTKWRDA-QNCIYENK------------------------------
  BM:BM40734/1-1088              LNAPISCAHFEHINLEQWIDR-PRCYVGNI------------------------------
  WP:CE43668/1-1537              TNSPMTCSELSEIDLNKWVER-DYCLVDER------------------------------
  OV:OVP00967/1-1231             TNAPMKCSELSDIDLYEWLDR-QFCVVDHR------------------------------
  SRP:SRP05421/1-1534            MNSLVDCENLGKINLNEWKED-LSCQIKDK------------------------------
  PP:PP23975/1-1495              MNAQVSCKDIPQIDLSHWKDR-RHCEMNGR------------------------------
  BP:CBP00571/1-1491             TNAQVPCSDIPQVDLSLWKER-KTCEMNGR------------------------------
  JA:JA48044/1-1261              TNAQVPCSDIPQIDISLWKER-KTCEMNGR------------------------------
                                  :    *     :::  * :    *                                   
  
  
  SW:Q3UQ28/1-1475               KALSV-KHGKHLSNATSATHEHLEGPATNDLKEFVLEMQKIITDLRKQINSLESRLSTTE
  ENSEMBL:ENSP00000252804/1-1479 KIPSVGRQGEHLSNSTSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTE
  FLYBASE:CG10211/1-1394         ----------------------------------NVRVGESA------------------
  RP:RP34620/1-1237              ----------------------------------TIALHSTA------------------
  CN:CN38022/1-1295              ----------------------------------YIPLHTAV------------------
  BM:BM40734/1-1088              ----------------------------------IIAPDEIK------------------
  WP:CE43668/1-1537              ----------------------------------VVNRGKTK------------------
  OV:OVP00967/1-1231             ----------------------------------VINLGRTK------------------
  SRP:SRP05421/1-1534            ----------------------------------EIELGKTI------------------
  PP:PP23975/1-1495              ----------------------------------TIQMGEST------------------
  BP:CBP00571/1-1491             ----------------------------------SIALGDSV------------------
  JA:JA48044/1-1261              ----------------------------------SIALGDSV------------------
                                                                    :                        
  
  
  SW:Q3UQ28/1-1475               CVDDSGESHGGNTKWKKDPCTVCECKNGQITCF---VEACQPAACPQPVK--VEGACCPV
  ENSEMBL:ENSP00000252804/1-1479 CVDAGGESHANNTKWKKDACTICECKDGQVTCF---VEACPPATCAVPVN--IPGACCPV
  FLYBASE:CG10211/1-1394         ---------------FPSPCTSCVCSAEGAQCASLRITDCGQLIRQWPKEAILRDEVCNS
  RP:RP34620/1-1237              ---------------EISPCTKCTCTSDG-------------------------DPICFM
  CN:CN38022/1-1295              ---------------EISPCTKCICSSDG-------------------------DPVCFM
  BM:BM40734/1-1088              ---------------RISPCQSCTCTDNGSQCDTITIRNCIALFSQYPFDEIMKDTACIV
  WP:CE43668/1-1537              ---------------RITPCITCTCTLEGPECHSITIDDCSRLLRDYSITDIQKDPVCLI
  OV:OVP00967/1-1231             ---------------RITPCITCTCTAEGPECHSMVIDRCESLLTDYLFSEVIADTVCVI
  SRP:SRP05421/1-1534            ---------------DITPCVSCTCTKDGTICHPKKIINCEKLLSMFSKNEILNDTSCII
  PP:PP23975/1-1495              ---------------HITPCITCTCTLEGVMCNPTRVNSCEKLSHKYLFSDISKDTSCMI
  BP:CBP00571/1-1491             ---------------HMTPCVTCTCTLEGVACNPTKVDSCEKLTHKYLLTDIAKDTSCMI
  JA:JA48044/1-1261              ---------------HMTPCVTCTCTLEGVTCNPTKVDSCEKLTHKYLITDIAKDTSCMI
                                                   .*  * *.                            .  *  
  
  
  SW:Q3UQ28/1-1475               -CLKNTAEEKP-------------------------------------
  ENSEMBL:ENSP00000252804/1-1479 -CLQKRAEEKP-------------------------------------
  FLYBASE:CG10211/1-1394         QCGIYLTGQQASGFNPQQRQGQAQPRVTRSRNQNLFKFPDLTPFIASL
  RP:RP34620/1-1237              QCAHQIRDT---------------------------------------
  CN:CN38022/1-1295              QCAHRIRDNY--------------------------------------
  BM:BM40734/1-1088              QCAHLLREPK--------------------------------------
  WP:CE43668/1-1537              QCSQQLKKL---------------------------------------
  OV:OVP00967/1-1231             QCSSLIRQRSRQL-----------------------------------
  SRP:SRP05421/1-1534            QCSILLKK----------------------------------------
  PP:PP23975/1-1495              QCSEMMKTRK--------------------------------------
  BP:CBP00571/1-1491             QCTDYMKRV---------------------------------------
  JA:JA48044/1-1261              QCTDYMKRV---------------------------------------
                                  *